You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GPN3
GPN-loop GTPase 3

Protein Summary
Description
Small GTPase required for proper localization of RNA polymerase II (RNAPII). May act at an RNAP assembly step prior to nuclear import.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000228827
  • ENSP00000228827
  • ENSG00000111231
  • ENST00000537466
  • ENSP00000443068
  • ENST00000543199
  • ENSP00000442770

Symbol
  • ATPBD1C
  • ATPBD1C
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.92
kinase perturbation
0.84
molecular function
0.81
transcription factor binding site profile
0.8
tissue sample
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.06   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 51   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.06   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 51   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (118)
1 – 10 of 118
POLR2M
Tbio
Family: Enzyme
Novelty: 0.10421601
p_int: 0.999999963
p_ni: 3.7e-8
Score: 0.594
Data Source: BioPlex,STRINGDB
POLR3E
Tbio
Family: Enzyme
Novelty: 0.00736648
p_int: 0.999998952
p_ni: 0.000001048
Score: 0.69
Data Source: BioPlex,STRINGDB
POLR3D
Tbio
Family: Enzyme
Novelty: 0.03502574
p_int: 0.999998614
p_ni: 0.000001386
Score: 0.795
Data Source: BioPlex,STRINGDB
RPAP2
Tbio
Family: Enzyme
Novelty: 0.07575758
p_int: 0.999983337
p_ni: 0.000016663
Score: 0.947
Data Source: BioPlex,STRINGDB
POLR2G
Tbio
Family: Enzyme
Novelty: 0.01513348
p_int: 0.999969909
p_ni: 0.000030091
Score: 0.851
Data Source: BioPlex,STRINGDB
POLR3H
Tbio
Family: Enzyme
Novelty: 0.04474273
p_int: 0.999877223
p_ni: 0.000122748
p_wrong: 2.9e-8
Score: 0.815
Data Source: BioPlex,STRINGDB
POLR2D
Tdark
Family: Enzyme
Novelty: 0.27988338
p_int: 0.999249167
p_ni: 0.000750833
Score: 0.804
Data Source: BioPlex,STRINGDB
POLR1E
Tbio
Family: Enzyme
Novelty: 0.11637573
p_int: 0.999059782
p_ni: 0.00094006
p_wrong: 1.59e-7
Score: 0.253
Data Source: BioPlex,STRINGDB
POLR3B
Tbio
Family: Enzyme
Novelty: 0.05095277
p_int: 0.999018637
p_ni: 0.000981363
Score: 0.802
Data Source: BioPlex,STRINGDB
CD3EAP
Tbio
Family: Enzyme
Novelty: 0.06090487
p_int: 0.998468867
p_ni: 0.001531121
p_wrong: 1.2e-8
Score: 0.525
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  4.06

PubMed score by year
PubTator Score  2.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLR
1-70
FGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLV
70-140
DSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKK
140-210
FKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQE
210-280
CQDE
280-284
MPRYAQLVMGPAGSGKSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFCMEYFANNFDWLENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCGVFLVDSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLEDSTSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDLEFKEPKEREDESSSMFDEYFQECQDE