You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SMOC2
SPARC-related modular calcium-binding protein 2

Protein Classes
Protein Summary
Description
Promotes matrix assembly and cell adhesiveness (By similarity). Can stimulate endothelial cell proliferation, migration, as well as angiogenesis. This gene encodes a member of the SPARC family (secreted protein acidic and rich in cysteine/osteonectin/BM-40), which are highly expressed during embryogenesis and wound healing. The gene product is a matricellular protein which promotes matrix assembly and can stimulate endothelial cell proliferation and migration, as well as angiogenic activity. Associated with pulmonary function, this secretory gene product contains a Kazal domain, two thymoglobulin type-1 domains, and two EF-hand calcium-binding domains. The encoded protein may serve as a target for controlling angiogenesis in tumor growth and myocardial ischemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354536
  • ENSP00000346537
  • ENSG00000112562
  • ENST00000356284
  • ENSP00000348630

Symbol
  • SMAP2
  • DTDP1
  • SMAP2
  • MST117
  • MSTP117
  • MSTP140
  • bA37D8.1
  • bA270C4A.1
  • dJ421D16.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
PubMedID
0.77
trait
0.75
tissue sample
0.62
disease
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.06   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 131   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.06   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 131   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (16)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (44)
1 – 10 of 44
SPOCK3
Tbio
Novelty: 0.17568949
Score: 0.679
Data Source: STRINGDB
DACT2
Tbio
Novelty: 0.06119733
Score: 0.658
Data Source: STRINGDB
TES
Tbio
Novelty: 0.00112939
Score: 0.644
Data Source: STRINGDB
FRMD1
Tdark
Novelty: 2.81564246
Score: 0.617
Data Source: STRINGDB
PHF10
Tbio
Family: Epigenetic
Novelty: 0.06950506
Score: 0.615
Data Source: STRINGDB
TCTE3
Tdark
Novelty: 0.1998141
Score: 0.599
Data Source: STRINGDB
SPARCL1
Tbio
Novelty: 0.01525848
Score: 0.595
Data Source: STRINGDB
STS
Tchem
Family: Enzyme
Novelty: 0.0020382
Score: 0.568
Data Source: STRINGDB
OLFM4
Tbio
Novelty: 0.01534099
Score: 0.558
Data Source: STRINGDB
LGR5
Tbio
Family: GPCR
Novelty: 0.00156297
Score: 0.547
Data Source: STRINGDB
Publication Statistics
PubMed Score  28.06

PubMed score by year
PubTator Score  20.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAK
1-70
CKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRP
70-140
ISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNK
140-210
NSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPK
210-280
CDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEER
280-350
VVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG
350-420
KADTKKRHTPRGHAESTSNRQPRKQG
420-446
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGHAESTSNRQPRKQG