You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SIRPD
Signal-regulatory protein delta

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.07   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 93   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.07   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 93   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (20)
1 – 10 of 20
EPDR1
Tbio
Novelty: 0.05021948
p_int: 0.993692909
p_ni: 0.00630618
p_wrong: 9.11e-7
Score: 0.209
Data Source: BioPlex,STRINGDB
DIRAS2
Tbio
Family: Enzyme
Novelty: 0.17840076
p_int: 0.982080654
p_ni: 0.017688993
p_wrong: 0.000230353
Score: 0.282
Data Source: BioPlex,STRINGDB
HIKESHI
Tbio
Novelty: 0.08920986
p_int: 0.90703592
p_ni: 0.090362362
p_wrong: 0.002601718
Score: 0.332
Data Source: BioPlex,STRINGDB
NT5C
Tbio
Family: Enzyme
Novelty: 0.00245707
p_int: 0.776472105
p_ni: 0.223527314
p_wrong: 5.81e-7
Score: 0.309
Data Source: BioPlex,STRINGDB
FAM162B
Tdark
Novelty: 3.15789474
Score: 0.589
Data Source: STRINGDB
C2orf74
Tdark
Novelty: 0.79808328
Score: 0.589
Data Source: STRINGDB
KIAA1841
Tdark
Novelty: 15
Score: 0.585
Data Source: STRINGDB
ZUP1
Tbio
Family: Enzyme
Novelty: 0.25641026
Score: 0.583
Data Source: STRINGDB
ZNF687
Tdark
Family: TF
Novelty: 0.29976334
Score: 0.542
Data Source: STRINGDB
MINDY4
Tdark
Novelty: 0.59322034
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.07

PubMed score by year
PubTator Score  0.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGP
1-70
NRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVT
70-140
EQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK
140-197
MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK