You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALS2CR12
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000286190
  • ENSP00000286190
  • ENSG00000155749
  • ENST00000392257
  • ENSP00000376086
  • ENST00000405148
  • ENSP00000385098
  • ENST00000439709
  • ENSP00000412073

Symbol
  • ALS2CR12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.63
interacting protein
0.63
protein complex
0.55
cellular component
0.52
tissue sample
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.91   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 72   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.91   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 72   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (14)
1 – 10 of 14
SULT2B1
Tbio
Family: Enzyme
Novelty: 0.00460759
Score: 0.782
Data Source: STRINGDB
C2CD6
Tdark
Novelty: 4
Score: 0.646
Data Source: STRINGDB
TRAK2
Tbio
Novelty: 0.07192089
Score: 0.587
Data Source: STRINGDB
C2orf74
Tdark
Novelty: 0.79808328
Score: 0.524
Data Source: STRINGDB
FAM126B
Tdark
Novelty: 2.85714286
Score: 0.495
Data Source: STRINGDB
NIF3L1
Tbio
Novelty: 0.21052632
Score: 0.493
Data Source: STRINGDB
RBM26
Tdark
Novelty: 0.86538462
Score: 0.454
Data Source: STRINGDB
FAM234A
Tdark
Novelty: 0.34567901
Score: 0.443
Data Source: STRINGDB
CASP8
Tchem
Family: Enzyme
Novelty: 0.00026844
Score: 0.428
Data Source: STRINGDB
CLEC14A
Tbio
Novelty: 0.0318057
Score: 0.422
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.91

PubMed score by year
PubTator Score  2.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQ
1-70
EETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAI
70-140
IEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEAHEAELSELENNYKAALKAEKLAAQEKLEEM
140-210
GKEYKYLKNMFRTYQDSIYDEMEEKWSKQKAKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINES
210-280
CSAVFENFIQEKEELLKQHQSDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALIL
280-350
ESLNTNLYYTQLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSG
350-420
RLASITVSKDDSDTVQDGSKKGQES
420-445
MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEAHEAELSELENNYKAALKAEKLAAQEKLEEMGKEYKYLKNMFRTYQDSIYDEMEEKWSKQKAKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINESCSAVFENFIQEKEELLKQHQSDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALILESLNTNLYYTQLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSGRLASITVSKDDSDTVQDGSKKGQES