You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PRAC1
Small nuclear protein PRAC1

Protein Summary
Description
This gene is reported to be specifically expressed in prostate, rectum and distal colon. Sequence analysis suggests that it may play a regulatory role in the nucleus. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000290294
  • ENSP00000290294
  • ENSG00000159182

Symbol
  • C17orf92
  • PRAC
  • PRAC
  • C17orf92
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.61
disease
0.58
tissue
0.48
tissue sample
0.36
biological term
0.33


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.41   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 77   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.41   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 77   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (12)
1 – 10 of 12
PRAC2
Tdark
Novelty: 0.47244094
Score: 0.939
Data Source: STRINGDB
HOXB13
Tbio
Family: TF
Novelty: 0.00783232
Score: 0.932
Data Source: STRINGDB
ZNF540
Tbio
Family: TF
Novelty: 1.4251497
Score: 0.583
Data Source: STRINGDB
PCDHAC1
Tdark
Novelty: 0.56856187
Score: 0.564
Data Source: STRINGDB
FAM78A
Tdark
Novelty: 2.24659258
Score: 0.557
Data Source: STRINGDB
ZNF671
Tbio
Family: TF
Novelty: 0.24580006
Score: 0.54
Data Source: STRINGDB
RIMS4
Tbio
Novelty: 0.11703383
Score: 0.532
Data Source: STRINGDB
ALKAL1
Tbio
Novelty: 0.03631107
Score: 0.475
Data Source: STRINGDB
ZNF154
Tbio
Family: TF
Novelty: 0.19152828
Score: 0.473
Data Source: STRINGDB
ERICH4
Tdark
Score: 0.426
Data Source: STRINGDB
Publication Statistics
PubMed Score  103.41

PubMed score by year
PubTator Score  45.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
1-70
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP