You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF333
Zinc finger protein 333

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000292530
  • ENSP00000292530
  • ENSG00000160961
  • ENST00000540689
  • ENSP00000438130

Symbol
  • KIAA1806
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.75
microRNA
0.59
protein domain
0.58
cell line
0.47
tissue
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.37   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 76   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.37   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 76   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Protein-Protein Interactions (11)
1 – 10 of 11
ARL15
Tbio
Family: Enzyme
Novelty: 0.0602724
p_int: 0.998195838
p_ni: 0.001782107
p_wrong: 0.000022055
Score: 0.349
Data Source: BioPlex,STRINGDB
ASPM
Tbio
Novelty: 0.00712035
p_int: 0.903587099
p_ni: 0.096412901
Score: 0.207
Data Source: BioPlex,STRINGDB
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
Score: 0.968
Data Source: STRINGDB
TMEM44
Tdark
Novelty: 9
Score: 0.711
Data Source: STRINGDB
RHOBTB2
Tbio
Novelty: 0.01298176
Score: 0.489
Data Source: STRINGDB
ZNF385B
Tbio
Novelty: 0.25732666
Score: 0.463
Data Source: STRINGDB
NFATC2
Tbio
Family: TF
Novelty: 0.00358612
Score: 0.44
Data Source: STRINGDB
ING4
Tbio
Family: Epigenetic
Novelty: 0.01571567
Score: 0.433
Data Source: STRINGDB
ZNF474
Tdark
Novelty: 1.5
Score: 0.42
Data Source: STRINGDB
ADAMTS14
Tbio
Family: Enzyme
Novelty: 0.08828132
Score: 0.42
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.37

PubMed score by year
PubTator Score  2.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESVTFEDVAVEFIQEWALLDSARRSLCKYRMLDQCRTLASRGTPPCKPSCVSQLGQRAEPKATERGILR
1-70
ATGVAWESQLKPEELPSMQDLLEEASSRDMQMGPGLFLRMQLVPSIEERETPLTREDRPALQEPPWSLGC
70-140
TGLKAAMQIQRVVIPVPTLGHRNPWVARDSAVPARDPAWLQEDKVEEEAMAPGLPTACSQEPVTFADVAV
140-210
VFTPEEWVFLDSTQRSLYRDVMLENYRNLASVADQLCKPNALSYLEERGEQWTTDRGVLSDTCAEPQCQP
210-280
QEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQS
280-350
AHLIVPEKIRSGDKSYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHMRTHTGEK
350-420
PFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREH
420-490
SSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMRTHTGEK
490-560
PYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHS
560-630
SSLTVHKRTHVGRETIRNGSLPLSMSHPYCGPLAN
630-665
MESVTFEDVAVEFIQEWALLDSARRSLCKYRMLDQCRTLASRGTPPCKPSCVSQLGQRAEPKATERGILRATGVAWESQLKPEELPSMQDLLEEASSRDMQMGPGLFLRMQLVPSIEERETPLTREDRPALQEPPWSLGCTGLKAAMQIQRVVIPVPTLGHRNPWVARDSAVPARDPAWLQEDKVEEEAMAPGLPTACSQEPVTFADVAVVFTPEEWVFLDSTQRSLYRDVMLENYRNLASVADQLCKPNALSYLEERGEQWTTDRGVLSDTCAEPQCQPQEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQSAHLIVPEKIRSGDKSYACNKCEKSFRYSSDLIRHEKTHTAEKCFDCQECGQAFKYSSNLRRHMRTHTGEKPFECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQVLSRLSTLKSHMRTHTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGRAFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRETIRNGSLPLSMSHPYCGPLAN