You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TMX3
Protein disulfide-isomerase TMX3

Protein Summary
Description
Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase. This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The canonical protein encoded by this gene has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This gene is expressed in many tissues but has its highest expression in heart and skeletal muscle. It is expressed in the retinal neuroepithelium and lens epithelium in the developing murine eye and haploinsufficiency of this gene in humans and zebrafish is associated with microphthalmia. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299608
  • ENSP00000299608
  • ENSG00000166479
  • ENST00000562706
  • ENSP00000457262

Symbol
  • KIAA1830
  • TXNDC10
  • PDIA13
  • TXNDC10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.74
transcription factor perturbation
0.74
tissue
0.73
cell type or tissue
0.62
tissue sample
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.17   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.17   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Name
Explore in Pharos
Explore in Source
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Protein-Protein Interactions (36)
1 – 10 of 36
AP1G2
Tbio
Novelty: 0.19895784
p_int: 0.912915152
p_ni: 0.087084848
Score: 0.39
Data Source: BioPlex,STRINGDB
UNC50
Tbio
Novelty: 0.08669625
Score: 0.756
Data Source: STRINGDB
TXNDC12
Tbio
Novelty: 0.02131718
Score: 0.713
Data Source: STRINGDB
RIC3
Tbio
Novelty: 0.02945063
Score: 0.658
Data Source: STRINGDB
ERP29
Tbio
Novelty: 0.01607061
Score: 0.621
Data Source: STRINGDB
NMNAT1
Tbio
Family: Enzyme
Novelty: 0.01416255
Score: 0.616
Data Source: STRINGDB
TMEM252
Tdark
Novelty: 0.83193277
Score: 0.605
Data Source: STRINGDB
RTTN
Tbio
Novelty: 0.07133152
Score: 0.58
Data Source: STRINGDB
CANX
Tbio
Novelty: 0.00135361
Score: 0.57
Data Source: STRINGDB
CCDC102A
Tdark
Novelty: 8
Score: 0.57
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.17

PubMed score by year
PubTator Score  5.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEM
1-70
KSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQ
70-140
QMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFV
140-210
YDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDL
210-280
FHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGD
280-350
SILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQ
350-420
EQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD
420-454
MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQEQIEESKEQQEPSSGGSVVPTVQEPKDVLEKKKD