You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF414
Zinc finger protein 414

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000255616
  • ENSP00000255616
  • ENSG00000133250
  • ENST00000393927
  • ENSP00000377504

Symbol
  • ZFP414
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.83
tissue sample
0.67
kinase perturbation
0.66
transcription factor binding site profile
0.59
transcription factor
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.27   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 43   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.27   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 43   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (65)
1 – 10 of 65
KDM4B
Tchem
Family: Epigenetic
Novelty: 0.01988196
p_int: 0.999999646
p_ni: 3.52e-7
p_wrong: 2e-9
Score: 0.57
Data Source: BioPlex,STRINGDB
KDM4A
Tchem
Family: Epigenetic
Novelty: 0.0007891
p_int: 0.999999501
p_ni: 4.95e-7
p_wrong: 4e-9
Score: 0.58
Data Source: BioPlex,STRINGDB
ZRANB1
Tbio
Family: Enzyme
Novelty: 0.10432689
p_int: 0.999997125
p_ni: 0.000002462
p_wrong: 4.12e-7
Score: 0.206
Data Source: BioPlex,STRINGDB
ANKRD50
Tdark
Novelty: 1.68674699
p_int: 0.999996481
p_ni: 0.000003024
p_wrong: 4.96e-7
Score: 0.24
Data Source: BioPlex,STRINGDB
NOC4L
Tdark
Novelty: 0.37037037
p_int: 0.999983568
p_ni: 0.000016432
Data Source: BioPlex
EDRF1
Tdark
Novelty: 0.32061069
p_int: 0.999965527
p_ni: 0.000034472
p_wrong: 1e-9
Data Source: BioPlex
NOP14
Tbio
Novelty: 0.0868636
p_int: 0.999946235
p_ni: 0.000053765
Data Source: BioPlex
HSD17B8
Tbio
Family: Enzyme
Novelty: 0.01566425
p_int: 0.999932539
p_ni: 0.000051255
p_wrong: 0.000016206
Data Source: BioPlex
NPRL2
Tbio
Family: Enzyme
Novelty: 0.04015797
p_int: 0.999887821
p_ni: 0.000112179
Score: 0.513
Data Source: BioPlex,STRINGDB
ANKHD1
Tbio
Novelty: 0.08323329
p_int: 0.999565341
p_ni: 0.000434659
Score: 0.196
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  0.27

PubMed score by year
PubTator Score  0.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSP
1-70
APDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHLRTHCPPTQSL
70-140
EGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEHAQSPAPPPP
140-210
PALDREPPAPERPPEVDPASAPGLPFPLLEPFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPP
210-280
ASSAAVWKKSQGAGSSPRRPQGGSDAPSGACR
280-312
MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHLRTHCPPTQSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEHAQSPAPPPPPALDREPPAPERPPEVDPASAPGLPFPLLEPFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRPQGGSDAPSGACR