You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SCAMP4
Secretory carrier-associated membrane protein 4

Protein Classes
Protein Summary
Description
Probably involved in membrane protein trafficking. Secretory carrier membrane proteins (SCAMPs) are widely distributed integral membrane proteins implicated in membrane trafficking. Most SCAMPs (e.g., SCAMP1; MIM 606911) have N-terminal cytoplasmic NPF (arg-pro-phe) repeats, 4 central transmembrane regions, and a short C-terminal cytoplasmic tail. These SCAMPs likely have a role in endocytosis that is mediated by their NPF repeats. Other SCAMPs, such as SCAMP4, lack the NPF repeats and are therefore unlikely to function in endocytosis (summary by Fernandez-Chacon and Sudhof, 2000 [PubMed 11050114]).[supplied by OMIM, Feb 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316097
  • ENSP00000316007
  • ENSG00000227500
  • ENST00000409472
  • ENSP00000386865
  • ENST00000621748
  • ENSP00000479083

Symbol
  • SCAMP-4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.76
interacting protein
0.71
histone modification site profile
0.67
virus perturbation
0.64
tissue sample
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.87   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 82   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.87   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 82   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (24)
1 – 10 of 24
GDPD5
Tbio
Family: Enzyme
Novelty: 0.06263048
p_int: 0.998087568
p_ni: 0.001906412
p_wrong: 0.00000602
Score: 0.38
Data Source: BioPlex,STRINGDB
REEP5
Tbio
Novelty: 0.00356586
p_int: 0.976479677
p_ni: 0.023199915
p_wrong: 0.000320408
Score: 0.406
Data Source: BioPlex,STRINGDB
ABHD17A
Tbio
Family: Enzyme
Novelty: 0.45893806
Score: 0.737
Data Source: STRINGDB
DUS3L
Tdark
Family: Enzyme
Novelty: 0.34285714
Score: 0.685
Data Source: STRINGDB
REXO1
Tdark
Family: Enzyme
Novelty: 0.4893617
Score: 0.674
Data Source: STRINGDB
SH3GL1
Tbio
Novelty: 0.00957396
Score: 0.595
Data Source: STRINGDB
NMRK2
Tbio
Family: Kinase
Novelty: 0.00882056
Score: 0.543
Data Source: STRINGDB
ZBTB21
Tbio
Family: TF
Novelty: 0.32967033
Score: 0.54
Data Source: STRINGDB
NAA50
Tbio
Family: Enzyme
Novelty: 0.00132901
Score: 0.536
Data Source: STRINGDB
OAZ1
Tbio
Family: Enzyme
Novelty: 0.03494222
Score: 0.517
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.87

PubMed score by year
PubTator Score  0.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTN
1-70
FGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGF
70-140
FQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSG
140-210
NSLPEYPTVPSYPGSGQWP
210-229
MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTNFGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP