You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C6orf201
Uncharacterized protein C6orf201

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380175
  • ENSP00000420610
  • ENSG00000185689

Symbol
  • dJ1013A10.5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 51   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 51   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Mesodermal Commitment Pathway
WikiPathways
Mesodermal Commitment Pathway
WikiPathways
Mesodermal Commitment Pathway
WikiPathways
Notch Signaling
WikiPathways
Preimplantation Embryo
Name
Explore in Pharos
Explore in Source
Mesodermal Commitment Pathway
Mesodermal Commitment Pathway
Mesodermal Commitment Pathway
Notch Signaling
Preimplantation Embryo
Protein-Protein Interactions (23)
1 – 10 of 23
CCDC73
Tdark
Novelty: 2.76923077
Score: 0.669
Data Source: STRINGDB
CEP170B
Tdark
Novelty: 0.42682927
Score: 0.645
Data Source: STRINGDB
RNFT2
Tdark
Score: 0.641
Data Source: STRINGDB
C2orf73
Tdark
Score: 0.63
Data Source: STRINGDB
FAM71E1
Tdark
Novelty: 2
Score: 0.626
Data Source: STRINGDB
C17orf98
Tdark
Score: 0.626
Data Source: STRINGDB
CCER1
Tdark
Novelty: 9
Score: 0.555
Data Source: STRINGDB
THSD1
Tbio
Novelty: 0.14679078
Score: 0.552
Data Source: STRINGDB
TMCO5A
Tdark
Novelty: 0.54794521
Score: 0.544
Data Source: STRINGDB
FAM71F1
Tdark
Novelty: 0.34361233
Score: 0.53
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MLSNLHELLPNHLMETLYSRKSEEDKKKCENPELSGLERILARHQLPKEINLTPKPNRMPPWKRKIINNV
1-70
TDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPTTAKGTQTGKSQCLLGISEPT
70-140
MLSNLHELLPNHLMETLYSRKSEEDKKKCENPELSGLERILARHQLPKEINLTPKPNRMPPWKRKIINNVTDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPTTAKGTQTGKSQCLLGISEPT