You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SEZ6L2
Seizure 6-like protein 2

Protein Summary
Description
May contribute to specialized endoplasmic reticulum functions in neurons. This gene encodes a seizure-related protein that is localized on the cell surface. The gene is located in a region of chromosome 16p11.2 that is thought to contain candidate genes for autism spectrum disorders (ASD), though there is no evidence directly implicating this gene in ASD. Increased expression of this gene has been found in lung cancers, and the protein is therefore considered to be a novel prognostic marker for lung cancer. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308713
  • ENSP00000312550
  • ENSG00000174938
  • ENST00000346932
  • ENSP00000319215
  • ENST00000350527
  • ENSP00000310206
  • ENST00000537485
  • ENSP00000439412

Symbol
  • PSK
  • BSRPA
  • PSK-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
cell type or tissue
0.64
transcription factor
0.64
tissue sample
0.61
transcription factor perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.82   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 81   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.82   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 81   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (48)
1 – 10 of 48
FAM19A4
Tbio
Novelty: 0.04762169
p_int: 0.999995925
p_ni: 0.000004075
Score: 0.172
Data Source: BioPlex,STRINGDB
FCN1
Tbio
Novelty: 0.01220815
p_int: 0.999956044
p_ni: 0.000043956
p_wrong: 1e-9
Score: 0.257
Data Source: BioPlex,STRINGDB
IL1R2
Tbio
Novelty: 0.01061944
p_int: 0.997376214
p_ni: 0.002030452
p_wrong: 0.000593334
Score: 0.183
Data Source: BioPlex,STRINGDB
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.996476752
p_ni: 0.003207929
p_wrong: 0.000315319
Data Source: BioPlex
SERPINA12
Tbio
Novelty: 0.00636095
p_int: 0.98038961
p_ni: 0.019401033
p_wrong: 0.000209357
Score: 0.183
Data Source: BioPlex,STRINGDB
ASPHD1
Tdark
Family: Enzyme
Score: 0.911
Data Source: STRINGDB
PRRT2
Tbio
Novelty: 0.00330276
Score: 0.792
Data Source: STRINGDB
DOC2A
Tbio
Novelty: 0.1619121
Score: 0.782
Data Source: STRINGDB
HIRIP3
Tdark
Novelty: 0.64900846
Score: 0.746
Data Source: STRINGDB
KIF22
Tbio
Novelty: 0.02073357
Score: 0.728
Data Source: STRINGDB
Publication Statistics
PubMed Score  15.82

PubMed score by year
PubTator Score  7.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEILPEPGSETPTVASEALAELLHGALLRRGPEMGYLP
1-70
GSDRDPTLATPPAGQTLAVPSLPRATEPGTGPLTTAVTPNGVRGAGPTAPELLTPPPGTTAPPPPSPASP
70-140
GPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGYVESPDLGSPVSRTLGLLDCTYSIHVYP
140-210
GYGIEIQVQTLNLSQEEELLVLAGGGSPGLAPRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFR
210-280
IHYQAYLLSCGFPPRPAHGDVSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCG
280-350
GTIHNATLGRIVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
350-420
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFS
420-490
CLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQ
490-560
EEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQG
560-630
FVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQ
630-700
KIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEP
700-770
CLNPGVPENGYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
770-840
EGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGDTREYEVSI
840-910
MGTPRAQHPPPPQLLFLILLSCPWIQGLPLKEEEILPEPGSETPTVASEALAELLHGALLRRGPEMGYLPGSDRDPTLATPPAGQTLAVPSLPRATEPGTGPLTTAVTPNGVRGAGPTAPELLTPPPGTTAPPPPSPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGYVESPDLGSPVSRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGLAPRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGDVSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCGGTIHNATLGRIVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPGQDCVWGVHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASDAGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGYQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQLEGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGDTREYEVSI