You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOXI1
Forkhead box protein I1

Protein Summary
Description
Transcriptional activator required for the development of normal hearing, sense of balance and kidney function. Required for the expression of SLC26A4/PDS, JAG1 and COCH in a subset of epithelial cells and the development of the endolymphatic system in the inner ear. Also required for the expression of SLC4A1/AE1, SLC4A9/AE4, ATP6V1B1 and the differentiation of intercalated cells in the epithelium of distal renal tubules (By similarity). This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4. [provided by RefSeq, Jan 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306268
  • ENSP00000304286
  • ENSG00000168269
  • ENST00000449804
  • ENSP00000415483

Symbol
  • FKHL10
  • FREAC6
  • HFH3
  • FKH10
  • HFH-3
  • FKHL10
  • FREAC6
  • FREAC-6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.88
molecular function
0.79
cell type or tissue
0.57
biological process
0.56
small molecule perturbation
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.76   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 438   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.76   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 438   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (16)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (54)
1 – 10 of 54
SLC26A4
Tbio
Family: Transporter
Novelty: 0.00186048
Score: 0.857
Data Source: STRINGDB
ATP6V1B1
Tchem
Family: Enzyme
Novelty: 0.01558567
Score: 0.809
Data Source: STRINGDB
PAX8
Tbio
Family: TF
Novelty: 0.00201585
Score: 0.744
Data Source: STRINGDB
SRSF11
Tbio
Novelty: 0.35984111
Score: 0.663
Data Source: STRINGDB
CA2
Tclin
Family: Enzyme
Novelty: 0.0002565
Score: 0.646
Data Source: STRINGDB
FBXO6
Tbio
Novelty: 0.05038914
Score: 0.643
Data Source: STRINGDB
EYA1
Tbio
Novelty: 0.00726757
Score: 0.622
Data Source: STRINGDB
GJB2
Tbio
Novelty: 0.00063266
Score: 0.61
Data Source: STRINGDB
KCNJ10
Tbio
Family: IC
Novelty: 0.00337611
Score: 0.588
Data Source: STRINGDB
SIX1
Tbio
Family: TF
Novelty: 0.00201882
Score: 0.579
Data Source: STRINGDB
Publication Statistics
PubMed Score  29.76

PubMed score by year
PubTator Score  19.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM
1-70
TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP
70-140
DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNG
140-210
NFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNS
210-280
FLSSMTAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGG
280-350
SVLSQFSPHFYNSVNTSGVLYPREGTEV
350-378
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV