You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CREB5
Cyclic AMP-responsive element-binding protein 5

Protein Summary
Description
Binds to the cAMP response element and activates transcription. The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357727
  • ENSP00000350359
  • ENSG00000146592
  • ENST00000396298
  • ENSP00000379592
  • ENST00000396299
  • ENSP00000379593
  • ENST00000396300
  • ENSP00000379594
  • ENST00000409603
  • ENSP00000387197

Symbol
  • CREBPA
  • CREB-5
  • CREBPA
  • CRE-BPA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.93
virus perturbation
0.9
kinase perturbation
0.84
transcription factor
0.81
microRNA
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.89   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 193   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.89   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 193   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (58)
Items per page:
1 – 5 of 31
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
PI3K-Akt signaling pathway
KEGG
Parathyroid hormone synthesis, secretion and action
KEGG
Cortisol synthesis and secretion
KEGG
Relaxin signaling pathway
KEGG
Aldosterone synthesis and secretion
Name
Explore in Pharos
Explore in Source
PI3K-Akt signaling pathway
Parathyroid hormone synthesis, secretion and action
Cortisol synthesis and secretion
Relaxin signaling pathway
Aldosterone synthesis and secretion
Protein-Protein Interactions (80)
1 – 10 of 80
ATF2
Tbio
Family: TF
Novelty: 0.00562547
p_int: 0.999999999
p_ni: 1e-9
Score: 0.972
Data Source: BioPlex,STRINGDB
BACH1
Tbio
Family: TF
Novelty: 0.08874416
p_int: 0.999999998
p_ni: 2e-9
Score: 0.738
Data Source: BioPlex,STRINGDB
JUNB
Tbio
Family: TF
Novelty: 0.01119828
p_int: 0.999999947
p_ni: 5.2e-8
p_wrong: 1e-9
Score: 0.895
Data Source: BioPlex,STRINGDB
FOSL2
Tbio
Family: TF
Novelty: 0.006377
p_int: 0.999999838
p_ni: 1.61e-7
Score: 0.748
Data Source: BioPlex,STRINGDB
CEBPG
Tbio
Family: TF
Novelty: 0.1187853
p_int: 0.999999738
p_ni: 2.62e-7
Data Source: BioPlex
FOS
Tbio
Family: TF
Novelty: 0.00007002
p_int: 0.999997489
p_ni: 0.000002506
p_wrong: 5e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
ARIH1
Tbio
Family: Enzyme
Novelty: 0.00502889
p_int: 0.999993715
p_ni: 0.000006283
p_wrong: 1e-9
Score: 0.668
Data Source: BioPlex,STRINGDB
ATF7
Tbio
Family: TF
Novelty: 0.01433182
p_int: 0.999979475
p_ni: 0.000020525
Score: 0.867
Data Source: BioPlex,STRINGDB
MLLT6
Tdark
Family: Epigenetic
Novelty: 0.04069948
p_int: 0.999972508
p_ni: 0.000027492
Score: 0.713
Data Source: BioPlex,STRINGDB
BATF3
Tbio
Family: TF
Novelty: 0.01678998
p_int: 0.999932162
p_ni: 0.000061127
p_wrong: 0.000006712
Score: 0.813
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  10.89

PubMed score by year
PubTator Score  11.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE
1-70
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS
70-140
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG
140-210
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ
210-280
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM
280-350
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
350-420
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG
420-490
SSTLSQLTTHRTDLNPIL
490-508
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL