You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLIN5
Perilipin-5

Protein Summary
Description
Lipid droplet-associated protein that maintains the balance between lipogenesis and lipolysis and also regulates fatty acid oxidation in oxidative tissues. Recruits mitochondria to the surface of lipid droplets and is involved in lipid droplet homeostasis by regulating both the storage of fatty acids in the form of triglycerides and the release of fatty acids for mitochondrial fatty acid oxidation. In lipid droplet triacylglycerol hydrolysis, plays a role as a scaffolding protein for three major key lipolytic players: ABHD5, PNPLA2 and LIPE. Reduces the triacylglycerol hydrolase activity of PNPLA2 by recruiting and sequestering PNPLA2 to lipid droplets. Phosphorylation by PKA enables lipolysis probably by promoting release of ABHD5 from the perilipin scaffold and by facilitating interaction of ABHD5 with PNPLA2. Also increases lipolysis through interaction with LIPE and upon PKA-mediated phosphorylation of LIPE (By similarity). Members of the perilipin family, such as PLIN5, coat intra ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381848
  • ENSP00000371272
  • ENSG00000214456

Symbol
  • LSDP5
  • OXPAT
  • PAT-1
  • MLDP
  • LSDA5
  • LSDP5
  • OXPAT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
transcription factor perturbation
0.74
biological process
0.67
virus perturbation
0.64
tissue sample
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 74.23   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 74.23   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (19)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (33)
1 – 10 of 33
CFLAR
Tbio
Novelty: 0.00120225
p_int: 0.999996885
p_ni: 0.000003115
Score: 0.538
Data Source: BioPlex,STRINGDB
SAPCD2
Tbio
Novelty: 0.07060586
p_int: 0.999941801
p_ni: 0.000058188
p_wrong: 1e-8
Score: 0.52
Data Source: BioPlex,STRINGDB
ENC1
Tbio
Novelty: 0.00832731
p_int: 0.998483427
p_ni: 0.000983319
p_wrong: 0.000533254
Score: 0.282
Data Source: BioPlex,STRINGDB
METAP2
Tchem
Family: Enzyme
Novelty: 0.00715704
p_int: 0.990152942
p_ni: 0.009847058
Score: 0.211
Data Source: BioPlex,STRINGDB
INPPL1
Tchem
Family: Enzyme
Novelty: 0.00821462
p_int: 0.976179596
p_ni: 0.023820404
Score: 0.196
Data Source: BioPlex,STRINGDB
PNPLA2
Tchem
Family: Enzyme
Novelty: 0.00183906
Score: 0.924
Data Source: STRINGDB
ABHD5
Tbio
Family: Enzyme
Novelty: 0.00998736
Score: 0.857
Data Source: STRINGDB
LIPE
Tchem
Family: Enzyme
Novelty: 0.00159068
Score: 0.734
Data Source: STRINGDB
CIDEA
Tbio
Novelty: 0.01325157
Score: 0.728
Data Source: STRINGDB
CIDEC
Tbio
Novelty: 0.01333028
Score: 0.689
Data Source: STRINGDB
Publication Statistics
PubMed Score  74.23

PubMed score by year
PubTator Score  43.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTR
1-70
ALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVDLARRGRRWS
70-140
VELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGYFVRLGSLSARIRH
140-210
LAYEHSVGKLRQSKHRAQDTLAQLQETLELIDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAE
210-280
LETLVLSRSLTQELQGTVEALESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGR
280-350
VAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
350-420
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF
420-463
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLELIDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEALESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF