You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MAP4
Microtubule-associated protein 4

Protein Summary
Description
Non-neuronal microtubule-associated protein. Promotes microtubule assembly. The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360240
  • ENSP00000353375
  • ENSG00000047849
  • ENST00000395734
  • ENSP00000379083
  • ENST00000434267
  • ENSP00000402767
  • ENST00000439356
  • ENSP00000397414
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
ligand (protein) perturbation
1
disease perturbation
0.97
microRNA
0.97
kinase perturbation
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 192.19   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 336   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 192.19   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 336   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Splicing factor NOVA regulated synaptic proteins
WikiPathways
Splicing factor NOVA regulated synaptic proteins
WikiPathways
Splicing factor NOVA regulated synaptic proteins
WikiPathways
Splicing factor NOVA regulated synaptic proteins
WikiPathways
Vitamin D Receptor Pathway
Name
Explore in Pharos
Explore in Source
Splicing factor NOVA regulated synaptic proteins
Splicing factor NOVA regulated synaptic proteins
Splicing factor NOVA regulated synaptic proteins
Splicing factor NOVA regulated synaptic proteins
Vitamin D Receptor Pathway
Gene Ontology Terms (20)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (76)
1 – 10 of 76
MYO1F
Tbio
Novelty: 0.08092699
Score: 0.8
Data Source: STRINGDB
MYO10
Tbio
Novelty: 0.02610775
Score: 0.761
Data Source: STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.758
Data Source: STRINGDB
MYO1A
Tbio
Novelty: 0.00875836
Score: 0.745
Data Source: STRINGDB
MAP1B
Tchem
Novelty: 0.00233868
Score: 0.725
Data Source: STRINGDB
MAP1S
Tbio
Novelty: 0.03122174
Score: 0.685
Data Source: STRINGDB
MARK3
Tchem
Family: Kinase
Novelty: 0.00310794
Score: 0.677
Data Source: STRINGDB
FLNB
Tbio
Novelty: 0.00295671
Score: 0.676
Data Source: STRINGDB
MAP6
Tbio
Novelty: 0.00749518
Score: 0.667
Data Source: STRINGDB
MAP7
Tbio
Novelty: 0.02738196
Score: 0.658
Data Source: STRINGDB
Publication Statistics
PubMed Score  192.19

PubMed score by year
PubTator Score  124.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSET
1-70
SQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDP
70-140
FKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVA
140-210
EPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMES
210-280
PTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTL
280-350
LKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQ
350-420
ANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAK
420-490
DVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAK
490-560
DGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTG
560-630
TGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKK
630-700
TKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKD
700-770
VKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTE
770-840
GKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTS
840-910
AKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGP
910-980
IASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPG
980-1050
GGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPT
1050-1120
SASGLNGHPTLSGGGDQREAQTLDSQIQETSI
1120-1152
MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTGSPTEFLEEKMAYQEYPNSQNWPEDTNFCFQPEQVVDPIQTDPFKMYHDDDLADLVFPSSATADTSIFAGQNDPLKDSYGMSPCNTAVVPQGWSVEALNSPHSESFVSPEAVAEPPQPTAVPLELAKEIEMASEERPPAQALEIMMGLKTTDMAPSKETEMALAKDMALATKTEVALAKDMESPTKLDVTLAKDMQPSMESDMALVKDMELPTEKEVALVKDVRWPTETDVSSAKNVVLPTETEVAPAKDVTLLKETERASPIKMDLAPSKDMGPPKENKKETERASPIKMDLAPSKDMGPPKENKIVPAKDLVLLSEIEVAQANDIISSTEISSAEKVALSSETEVALARDMTLPPETNVILTKDKALPLEAEVAPVKDMAQLPETEIAPAKDVAPSTVKEVGLLKDMSPLSETEMALGKDVTPPPETEVVLIKNVCLPPEMEVALTEDQVPALKTEAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGTGKKCSLPAEEDSVLEKLGERKPCNSQPSELSSETSGIARPEEGRPVVSGTGNDITTPPNKELPPSPEKKTKPLATTQPAKTSTSKAKTQPTSLPKQPAPTTIGGLNKKPMSLASGLVPAAPPKRPAVASARPSILPSKDVKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTEGKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI