You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
APBB3
Amyloid-beta A4 precursor protein-binding family B member 3

Protein Summary
Description
May modulate the internalization of amyloid-beta precursor protein. The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000354402
  • ENSP00000346378
  • ENSG00000113108
  • ENST00000356738
  • ENSP00000349177
  • ENST00000357560
  • ENSP00000350171
  • ENST00000412920
  • ENSP00000402591
  • ENST00000467078
  • ENSP00000422718
  • ENST00000509914
  • ENSP00000426107

Symbol
  • FE65L2
  • SRA
  • FE65L2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
cell type or tissue
0.73
transcription factor binding site profile
0.73
virus perturbation
0.68
small molecule perturbation
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.43   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 160   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.43   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 160   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (26)
1 – 10 of 26
RHOBTB1
Tbio
Novelty: 0.04346745
p_int: 1
Score: 0.625
Data Source: BioPlex,STRINGDB
RHOBTB2
Tbio
Novelty: 0.01298176
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.218
Data Source: BioPlex,STRINGDB
APLP1
Tbio
Novelty: 0.0120099
p_int: 0.999980979
p_ni: 0.000018897
p_wrong: 1.25e-7
Score: 0.699
Data Source: BioPlex,STRINGDB
APLP2
Tbio
Novelty: 0.00824031
p_int: 0.999721246
p_ni: 0.000278754
Score: 0.715
Data Source: BioPlex,STRINGDB
APP
Tchem
Novelty: 0.00011446
p_int: 0.99957742
p_ni: 0.00042258
Score: 0.681
Data Source: BioPlex,STRINGDB
COPS2
Tbio
Novelty: 0.09131066
p_int: 0.9995568
p_ni: 0.0004432
Score: 0.759
Data Source: BioPlex,STRINGDB
COPS7B
Tbio
Novelty: 1.26436782
p_int: 0.995364963
p_ni: 0.004635037
Score: 0.764
Data Source: BioPlex,STRINGDB
COPS3
Tbio
Novelty: 0.07789318
p_int: 0.994030001
p_ni: 0.005969999
Score: 0.708
Data Source: BioPlex,STRINGDB
COPS7A
Tbio
Novelty: 0.04214752
p_int: 0.992806126
p_ni: 0.007193874
Score: 0.691
Data Source: BioPlex,STRINGDB
COPS5
Tbio
Novelty: 0.00481687
p_int: 0.991976905
p_ni: 0.008023095
Score: 0.708
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  4.43

PubMed score by year
PubTator Score  8.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPTWELGDAEDPG
1-70
TGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSS
70-140
IAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRVWGVGSSKGRD
140-210
RDFAFVASDKDSCMLKCHVFCCDVPAKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVEL
210-280
LDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTE
280-350
EEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAA
350-420
RGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDAFRLKPSLLHMP
420-486
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPTWELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVASDKDSCMLKCHVFCCDVPAKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDAFRLKPSLLHMP