You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LILRB5
Leukocyte immunoglobulin-like receptor subfamily B member 5

Protein Classes
Protein Summary
Description
May act as receptor for class I MHC antigens. This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). Several other LIR subfamily B receptors are expressed on immune cells where they bind to MHC class I molecules on antigen-presenting cells and inhibit stimulation of an immune response. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316219
  • ENSP00000320390
  • ENSG00000105609
  • ENST00000345866
  • ENSP00000263430
  • ENST00000449561
  • ENSP00000406478
  • ENST00000610764
  • ENSP00000479022
  • ENSG00000277414
  • ENST00000614318
  • ENSP00000483649
  • ENSG00000278437
  • ENST00000615429
  • ENSP00000482404
  • ENSG00000274311
  • ENST00000615837
  • ENSP00000478835
  • ENST00000616618
  • ENSP00000478912
  • ENST00000616805
  • ENSP00000483502
  • ENSG00000273991
  • ENST00000617355
  • ENSP00000483481
  • ENST00000619608
  • ENSP00000479413
  • ENST00000620714
  • ENSP00000480909
  • ENST00000621193
  • ENSP00000482062
  • ENST00000621867
  • ENSP00000481263
  • ENST00000622596
  • ENSP00000482535

Symbol
  • LIR8
  • LIR8
  • CD85C
  • LIR-8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.6
cell line
0.54
tissue
0.49
protein complex
0.41
protein domain
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.55   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.55   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (85)
1 – 10 of 85
HLA-G
Tbio
Novelty: 0.00082058
Score: 0.929
Data Source: STRINGDB
HLA-F
Tbio
Novelty: 0.01349191
Score: 0.924
Data Source: STRINGDB
HLA-E
Tbio
Novelty: 0.00263667
Score: 0.924
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.918
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.55

PubMed score by year
PubTator Score  4.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARK
1-70
RQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNV
70-140
TLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPS
140-210
DLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANF
210-280
TLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI
280-350
DTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP
350-420
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTS
420-490
AHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSL
490-560
TLRREATEPPPSQEREPPAEPSIYAPLAIH
560-590
MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTSAHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH