You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ATMIN
ATM interactor

Protein Summary
Description
Transcription factor. Plays a crucial role in cell survival and RAD51 foci formation in response to methylating DNA damage. Involved in regulating the activity of ATM in the absence of DNA damage. May play a role in stabilizing ATM. Binds to the DYNLL1 promoter and activates its transcription.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299575
  • ENSP00000299575
  • ENSG00000166454
  • ENST00000564241
  • ENSP00000463478
  • ENST00000566488
  • ENSP00000455497

Symbol
  • KIAA0431
  • ZNF822
  • ASCIZ
  • ZNF822
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.93
microRNA
0.68
tissue sample
0.68
transcription factor perturbation
0.68
cell type or tissue
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.85   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.85   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (20)
Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
ATM Signaling Network in Development and Disease
WikiPathways
ATM Signaling Network in Development and Disease
WikiPathways
ATM Signaling Network in Development and Disease
WikiPathways
ATM Signaling Network in Development and Disease
WikiPathways
miRNA Regulation of DNA Damage Response
Name
Explore in Pharos
Explore in Source
ATM Signaling Network in Development and Disease
ATM Signaling Network in Development and Disease
ATM Signaling Network in Development and Disease
ATM Signaling Network in Development and Disease
miRNA Regulation of DNA Damage Response
Protein-Protein Interactions (22)
1 – 10 of 22
CAPN13
Tbio
Novelty: 0.03153754
p_int: 0.999962502
p_ni: 0.000037498
Score: 0.331
Data Source: BioPlex,STRINGDB
SPECC1L
Tbio
Novelty: 0.12603151
p_int: 0.980708775
p_ni: 0.019291225
Score: 0.216
Data Source: BioPlex,STRINGDB
ATM
Tchem
Family: Kinase
Novelty: 0.00023967
Score: 0.889
Data Source: STRINGDB
DYNLL1
Tbio
Novelty: 0.00134262
Score: 0.828
Data Source: STRINGDB
DYNLL2
Tbio
Novelty: 0.16487634
Score: 0.697
Data Source: STRINGDB
WRNIP1
Tbio
Family: Enzyme
Novelty: 0.00257139
Score: 0.693
Data Source: STRINGDB
UBR5
Tbio
Family: Enzyme
Novelty: 0.00152012
Score: 0.549
Data Source: STRINGDB
CHEK2
Tchem
Family: Kinase
Novelty: 0.00089751
Score: 0.538
Data Source: STRINGDB
CDIP1
Tbio
Family: TF
Novelty: 0.02222222
Score: 0.52
Data Source: STRINGDB
EFCAB6
Tdark
Novelty: 0.15993266
Score: 0.514
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.85

PubMed score by year
PubTator Score  13.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASEAAAAAGSAALAAGARAVPAATTGAAAAASGPWVPPGPRLRGSRPRPAGATQQPAVPAPPAGELIQ
1-70
PSVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPR
70-140
GPERPFSQFSLVKQHFMKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQSHIY
140-210
RTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTD
210-280
KQTLTTPPRYPQKLLLPKPKVALVKLPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGT
280-350
LILGLDSEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPLQELGNTCQKNSISSINVQTDLSYA
350-420
SQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSKVTSSIAAQTDAFMDTCFQSGGVS
420-490
RETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLNQDIE
490-560
KSAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHRSLLSDTNPGPDTQLPSGPAQ
560-630
NPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEMF
630-700
DTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAKNIPALESKVQLNSTETQTMSS
700-770
GFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF
770-823
MAASEAAAAAGSAALAAGARAVPAATTGAAAAASGPWVPPGPRLRGSRPRPAGATQQPAVPAPPAGELIQPSVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPRGPERPFSQFSLVKQHFMKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQSHIYRTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTDKQTLTTPPRYPQKLLLPKPKVALVKLPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGTLILGLDSEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPLQELGNTCQKNSISSINVQTDLSYASQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSKVTSSIAAQTDAFMDTCFQSGGVSRETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLNQDIEKSAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHRSLLSDTNPGPDTQLPSGPAQNPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEMFDTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAKNIPALESKVQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF