You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SRRM4
Serine/arginine repetitive matrix protein 4

Protein Summary
Description
Splicing factor specifically required for neural cell differentiation. Acts in conjunction with nPTB/PTBP2 by binding directly to its regulated target transcripts and promotes neural-specific exon inclusion in many genes that function in neural cell differentiation. Required to promote the inclusion of neural-specific exon 10 in nPTB/PTBP2, leading to increased expression of neural-specific nPTB/PTBP2. Also promotes the inclusion of exon 16 in DAAM1 in neuron extracts. Promotes alternative splicing of REST transcripts to produce a REST isoform (REST4) with greatly reduced repressive activity, thereby activating expression of REST targets in neural cells. Plays an important role during embryonic development as well as in the proper functioning of the adult nervous system. Regulates alternative splicing events in genes with important neuronal functions (By similarity). SRRM4 promotes alternative splicing and inclusion of neural-specific exons in target mRNAs (Calarco et al., 2009 [PubMed ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267260
  • ENSP00000267260
  • ENSG00000139767

Symbol
  • KIAA1853
  • nSR100
  • KIAA1853
  • MU-MB-2.76
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.86
cell type or tissue
0.71
transcription factor binding site profile
0.7
cell line
0.67
PubMedID
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.15   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 47   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.15   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 47   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (39)
1 – 10 of 39
DAAM1
Tbio
Novelty: 0.03087963
Score: 0.904
Data Source: STRINGDB
PTBP2
Tbio
Novelty: 0.00788786
Score: 0.806
Data Source: STRINGDB
RBMX2
Tbio
Novelty: 0.09405059
Score: 0.769
Data Source: STRINGDB
CELF3
Tbio
Novelty: 0.07171754
Score: 0.73
Data Source: STRINGDB
RBFOX1
Tbio
Novelty: 0.00800456
Score: 0.682
Data Source: STRINGDB
NOVA2
Tbio
Novelty: 0.02462595
Score: 0.641
Data Source: STRINGDB
NOVA1
Tbio
Novelty: 0.01596804
Score: 0.623
Data Source: STRINGDB
SFSWAP
Tdark
Novelty: 0.32208589
Score: 0.61
Data Source: STRINGDB
MEX3B
Tbio
Novelty: 0.22768154
Score: 0.605
Data Source: STRINGDB
PTBP1
Tbio
Novelty: 0.00204645
Score: 0.556
Data Source: STRINGDB
Publication Statistics
PubMed Score  15.15

PubMed score by year
PubTator Score  8.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATE
1-70
PLGTNSWERDKTCRELGATRGHSASHDKDLTPPPSSRGKKKKKKSTRKKRRRSSSYSPSPVKKKKKKSSK
70-140
KHKRRRSFSKKRRHSSSSPKSKRRDEKRHKKQSRSRPRKSHRHRHHRCPSRSQSSESRPSSCESRHRGRS
140-210
PEEGQKSRRRHSRRCSKTLCKDSPEAQSSRPPSQPLQMLGYLSARGVITGSGSAADLFTKTASPLTTSRG
210-280
RSQEYDSGNDTSSPPSTQTSSARSRGQEKGSPSGGLSKSRELNSGNTSDSGNSFTTSSPQNKGAMLENLS
280-350
PTSRGRESRGFQSPCLECAEVKKSSLVPSTARSSPMKGCSRSSSYASTRSSSHSSRSPNPRASPRYTQSR
350-420
STSSEKRSYSRSPSYSSKSGKRSPPSRSSRSRRSPSYSRYSPSRERDPKYSEKDSQQRERERARRRRRSY
420-490
SPMRKRRRDSPSHLEARRITSARKRPIPYYRPSPSSSGSLSSTSSWYSSSSSRSASRSYSRSRSRSRSRR
490-560
RSRTRTSSSSSSRSPSPGSRSRSRSRSRSRSRSRSQSRSYSSADSYSSTRR
560-611
MASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELGATRGHSASHDKDLTPPPSSRGKKKKKKSTRKKRRRSSSYSPSPVKKKKKKSSKKHKRRRSFSKKRRHSSSSPKSKRRDEKRHKKQSRSRPRKSHRHRHHRCPSRSQSSESRPSSCESRHRGRSPEEGQKSRRRHSRRCSKTLCKDSPEAQSSRPPSQPLQMLGYLSARGVITGSGSAADLFTKTASPLTTSRGRSQEYDSGNDTSSPPSTQTSSARSRGQEKGSPSGGLSKSRELNSGNTSDSGNSFTTSSPQNKGAMLENLSPTSRGRESRGFQSPCLECAEVKKSSLVPSTARSSPMKGCSRSSSYASTRSSSHSSRSPNPRASPRYTQSRSTSSEKRSYSRSPSYSSKSGKRSPPSRSSRSRRSPSYSRYSPSRERDPKYSEKDSQQRERERARRRRRSYSPMRKRRRDSPSHLEARRITSARKRPIPYYRPSPSSSGSLSSTSSWYSSSSSRSASRSYSRSRSRSRSRRRSRTRTSSSSSSRSPSPGSRSRSRSRSRSRSRSRSQSRSYSSADSYSSTRR