You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
LRRC30
Leucine-rich repeat-containing protein 30

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000383467
  • ENSP00000372959
  • ENSG00000206422
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.88
cell line
0.56
tissue
0.42
protein domain
0.26
small molecule perturbation
0.17


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 6   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 6   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (40)
1 – 10 of 40
ATP1B4
Tdark
Family: Transporter
Novelty: 0.01060988
Score: 0.841
Data Source: STRINGDB
ANKRD12
Tdark
Novelty: 0.21201413
Score: 0.781
Data Source: STRINGDB
CDNF
Tbio
Novelty: 0.00799771
Score: 0.759
Data Source: STRINGDB
PPP4R1
Tbio
Family: Enzyme
Novelty: 0.14243726
Score: 0.737
Data Source: STRINGDB
C1QL1
Tdark
Novelty: 0.19017433
Score: 0.693
Data Source: STRINGDB
ZBTB14
Tbio
Family: TF
Novelty: 0.04135277
Score: 0.69
Data Source: STRINGDB
ADGRL1
Tbio
Family: GPCR
Novelty: 0.01343585
Score: 0.685
Data Source: STRINGDB
ADGRL2
Tbio
Family: GPCR
Novelty: 0.01111728
Score: 0.685
Data Source: STRINGDB
ADGRL3
Tbio
Family: GPCR
Novelty: 0.00182297
Score: 0.685
Data Source: STRINGDB
CHRNA1
Tclin
Family: IC
Novelty: 0.01910227
Score: 0.654
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGMTDIPDFLWGL
1-70
SEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVNMNCLTEVPAELSLCR
70-140
KLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPMCVFSLKELIFLHVGSNRLENIAESIQHLAS
140-210
LQIFIAEGNNIHSFPRSLCLVTSLELLNLNNNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPL
210-280
PELVEGGLEMLFGYLKDKKHT
280-301
MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGMTDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVNMNCLTEVPAELSLCRKLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPMCVFSLKELIFLHVGSNRLENIAESIQHLASLQIFIAEGNNIHSFPRSLCLVTSLELLNLNNNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFGYLKDKKHT