Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.2e-04
osteosarcoma 7950 2.9e-03
astrocytic glioma 2597 6.5e-03
oligodendroglioma 2850 8.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma 1.400 6.5e-03
group 3 medulloblastoma 1.100 2.2e-04
oligodendroglioma 1.400 8.1e-03
osteosarcoma -1.081 2.9e-03

AA Sequence

MAVMDLSSPWALTKQDSACFHLRNAEEERMIAVFLTTWLQEPMTFKDVAVEFTQEEWMMLDSAQRSLYRD      1 - 70
VMLENYRNLTSVEYQLYRLTVISPLDQEEIRNMKKRIPQAICPDQKIQPKTKESTVQKILWEEPSNAVKM     71 - 140
IKLTMHNWSSTLREDWECHKIRKQHKIPGGHWRQMIYAPKKTVPQELFRDYHELEENSKLGSKLIFSQSI    141 - 210
FTSKHCQKCYSEIGCLKHNSIINNYVKNSISEKLYESHECDTTLWHFQRNQTVQKEYTYSKHGMHFTHNM    211 - 280
FPVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFKRISNLTLYKKSHMGEKQYEC    281 - 350
KECGKVFNDSSTLRRHVRTHTGEKPYECNQCGKAFSQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLI    351 - 420
VHKRIHTGEKLYECSECGKAFNTSSHLKVHKKIHTGENVYECSDCGKVFSGVSSLRMHIRTHTGEKPYEC    421 - 490
KECRKAFSVSSSLRRHVRIHTGEKPYECIQCGKAFSQSSSLIIHKRIHTERETL                    491 - 544
//

Text Mined References (5)

PMID Year Title