Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.79
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.091 4.3e-02
atypical teratoid / rhabdoid tumor 1.400 1.4e-07
cystic fibrosis -1.279 8.7e-06
glioblastoma 1.200 4.3e-06
group 3 medulloblastoma 1.700 2.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 6.3e-03
pediatric high grade glioma 1.100 2.0e-04
pituitary cancer 1.100 8.0e-07
primitive neuroectodermal tumor 1.800 1.3e-03
psoriasis -1.500 2.9e-04

AA Sequence

MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEI      1 - 70
MVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTA     71 - 140
TQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKA    141 - 210
FNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIH    211 - 280
TGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKA    281 - 350
FNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIH    351 - 420
TGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKG    421 - 490
FKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIH    491 - 560
TGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI                                       561 - 595
//

Text Mined References (12)

PMID Year Title