Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.0e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.210 4.0e-05

AA Sequence

MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALC      1 - 70
PAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKA     71 - 140
LAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSD    141 - 210
MRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGP    211 - 280
GLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQ                               281 - 323
//

Text Mined References (7)

PMID Year Title