Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.500 7.6e-05
atypical teratoid / rhabdoid tumor -1.400 2.5e-05
ependymoma -1.100 5.9e-07
glioblastoma -1.300 6.7e-05
group 4 medulloblastoma -1.200 7.3e-04
medulloblastoma, large-cell -2.000 5.3e-06
osteosarcoma 1.622 1.2e-06
ovarian cancer -1.100 1.5e-03
primitive neuroectodermal tumor -1.100 1.4e-03

AA Sequence

MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGR      1 - 70
AFARRSTLAKHARTHTGERPFGCTECGRRFSQKSALTKHGRTHTGERPYECPECDKRFSAASNLRQHRRR     71 - 140
HTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDCGRAFGGSSCLARHRRTHTGERPYACADCGT    141 - 210
RFAQSSALAKHRRVHTGEKPHRCAVCGRRFGHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRA    211 - 280
HMRRRLYICAGCGRDFKLPPGATAATATERCPECEGS                                     281 - 317
//

Text Mined References (5)

PMID Year Title