Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 121 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 211
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Renal oncocytoma 21 4.348 2.2

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.040 7.5e-03
astrocytic glioma -1.100 4.1e-02
glioblastoma multiforme 1.400 1.6e-21
group 3 medulloblastoma 1.100 9.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.1e-03
osteosarcoma 1.604 4.2e-06
pediatric high grade glioma 1.100 3.3e-05

Gene RIF (1)

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEFSSTAQGNREVFH      1 - 70
AGTSQRHESHHNGDFCFQDIDKDIHDIEFQWQEDERNGHEALMTKIKKLTGSTERYDQNYAGNKPVKYQL     71 - 140
GFSFHSHLPELHIFHTEEKIDNQVVKSIHDASLVSTAQRISCRPETHISNDYGNNFLNSSLFTQKQEVHM    141 - 210
REKSFQCNDSGKAYNCSSLLRKHQLIHLGEKQYKCDICGKVFNSKRYVARHRRCHTGEKPYKCNECGKTF    211 - 280
SQTYYLTCHRRLHTGEKPYKCEECDKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFSQKSYLTCHRRLHT    281 - 350
GEKPYKCNECGKTFSRKSHFTCHHRVHTGEKPYKCNECSKTFSHKSSLTYHRRLHTEEKPYKCNECGKTF    351 - 420
NQQLTLNICRLHSGEKPYKCEECDKAYSFKSNLEIHQKIHTEENPYKCNECGKTFSRTSSLTYHHRLHTG    421 - 490
QKPYKCEDCDEAFSFKSNLERHRRIYTGEKLHV                                         491 - 523
//

Text Mined References (7)

PMID Year Title