Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 8.2e-03
atypical teratoid/rhabdoid tumor 1.300 7.1e-05
glioblastoma 1.300 6.3e-08
group 3 medulloblastoma 1.500 7.2e-03
primitive neuroectodermal tumor 1.300 1.3e-04

AA Sequence

MGVLTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYGNLVSLGLAIFKPDLMTCLEQRKEPWKVKRQEA      1 - 70
VAKHPAGSFHFTAEILPDHDIKDSFQKVILRKYGSCDLNNLHLKKDYQSVGNCKGQKSSYNGLHQCLSAT     71 - 140
HSKTCQCNKCGRGFQLCSIFTEHKDIFSREKCHKCEECGKDCRLFSDFTRHKKIHTVERCYKCEECGKAF    141 - 210
KKFSNLTEHKRVHTGEKPYKCEGCGKTFTCSSTLVKHKRNHTGDRPYKCEECGKAFKCFSDLTNHKRIHT    211 - 280
GEKPYKCEECNKAYRWFSDLAKHKIIHTGDKPYTCNECGKAFKWFSALSKHKRIHTGEKPYICEECGKAF    281 - 350
TRSSTLFNHKRIHMEERPYKCEECSKTFKCFSDLTNHKRIHTGEKPYKCEECGKASSWFSHLIRHKRIHT    351 - 420
REKLHKC                                                                   421 - 427
//

Text Mined References (4)

PMID Year Title