Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.47
PubTator Score 2.36

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.310 1.1e-03
sonic hedgehog group medulloblastoma 1.600 4.2e-05
primitive neuroectodermal tumor 1.100 1.5e-02
acute quadriplegic myopathy 1.196 1.2e-08
non-small cell lung cancer -1.004 2.8e-11
aldosterone-producing adenoma -1.067 5.6e-03
subependymal giant cell astrocytoma -1.132 2.7e-02
Breast cancer -1.200 1.5e-04
ulcerative colitis -1.200 8.7e-06
ovarian cancer -1.100 1.2e-04
pituitary cancer -1.400 7.9e-04

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

GYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPGQRRE                               1471 - 1512

Text Mined References (22)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24465431 2014 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.