Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.34

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.5e-11
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0


  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.349 2.5e-11

AA Sequence

VHKRIHTGERPFQCRQCGKAFSYSKSLHVHERTHSRQKP                                   491 - 529

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.