Property Summary

NCBI Gene PubMed Count 10
PubMed Score 37.13
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-02
astrocytic glioma 1.400 1.5e-02
atypical teratoid / rhabdoid tumor 1.100 6.3e-03
ependymoma 2.100 2.2e-03
intraductal papillary-mucinous carcinoma... 1.100 7.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.7e-03
lung cancer -1.200 1.6e-02
malignant mesothelioma -1.100 1.8e-06
medulloblastoma, large-cell 1.500 5.5e-04
oligodendroglioma 1.900 5.8e-04
osteosarcoma -1.275 4.2e-05
ovarian cancer -1.500 2.5e-07
Pick disease 1.200 1.4e-05
spina bifida -1.280 4.2e-02

AA Sequence

MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLG      1 - 70
PSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIV     71 - 140
NKNTPARVDACGSSVNGEVIMGHSSLNCYIRVDTGHKHRECHEYAEKSYTHKQCGKGLSYRHSFQTCERP    141 - 210
HTGKKPYDCKECGKTFSSPGNLRRHMVVKGGDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKQCSK    211 - 280
AFPVYSSYLRHEKIHTGEKPYECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERI    281 - 350
HTGEKPYTCKQCGKAFCHLGSFQRHMIMHSGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGK    351 - 420
LLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRTSSSLRKHETT    421 - 490
HTGEQPYKCKCGKAFSDLFSFQSHETTHSEEEPYECKECGKAFSSFKYFCRHERTHSEEKSYECQICGKA    491 - 560
FSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHERTHTGERPYECKHCGKAFSRSSFCREHERTH    561 - 630
TGEKPYECKECGKAFSSLSSFNRHKRTHWKDIL                                         631 - 663
//

Text Mined References (13)

PMID Year Title