Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.16
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
oligodendroglioma -1.400 3.6e-02
psoriasis -1.700 1.5e-03
cutaneous lupus erythematosus -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -1.100 3.3e-06
glioblastoma -1.400 8.3e-04
medulloblastoma, large-cell -2.200 6.2e-07
intraductal papillary-mucinous adenoma (... -2.400 4.7e-05
intraductal papillary-mucinous carcinoma... -1.600 2.8e-02
colon cancer -1.800 1.7e-05
active Crohn's disease -1.429 1.2e-02
active ulcerative colitis -1.759 2.8e-02
interstitial cystitis -1.200 8.3e-04
adult high grade glioma -1.200 3.5e-05
inflammatory breast cancer -1.100 1.1e-02
progressive supranuclear palsy -1.100 1.9e-02
ovarian cancer -1.200 6.8e-04
head and neck cancer -1.100 4.0e-02

Gene RIF (2)

PMID Text
22863851 ZfLp is a zinc finger protein that functions as a drug carrier protein.
17055453 ZNF415 isoforms in COS-7 cells inhibits the transcriptional activities of AP-1 and p53, suggesting that the ZNF415 protein may be involved in AP-1- and p53-mediated transcriptional activity.

AA Sequence

MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCENRLECNGAISA      1 - 70
HCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVTLEQHEKHDIEEFCFREIKKK     71 - 140
IHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYEC    141 - 210
NHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMT    211 - 280
VRQVSHSGEKGYKCDLCGKVFSQKSNLARHWRVHTGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKC    281 - 350
YECDKVFSRNSCLALHQKTHIGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLA    351 - 420
THQRIHTGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRRVHTGEKPYKC    421 - 490
NECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTGEKPYKCNECGKSFSVRPNLT    491 - 560
RHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN                               561 - 603
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22863851 2012 Functional characterization and substrate specificity of a novel gene encoding zinc finger-like protein, ZfLp, in Xenopus laevis oocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17055453 2006 A novel human gene ZNF415 with five isoforms inhibits AP-1- and p53-mediated transcriptional activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8619474 1996 A "double adaptor" method for improved shotgun library construction.