Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.16
PubTator Score 36.12

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MTAELREAMALAPWGPVKVKKEEEEEENFPGQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISW      1 - 70
DMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGAETKNLQLLVPKTEICEEAEKPLIISE     71 - 140
RIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSGGKYSLNSGAV    141 - 210
KNPKTQLGQKPFTCSVCGKGFSQSANLVVHQRIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVC    211 - 280
SKCGKAFTQSSNLTVHQKIHSLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLI    281 - 350
VHQRIHTGEKPFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDC    351 - 420
SECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECGKAFRQRSSLT    421 - 490
VHQRTHTGEKPYECEKCGAAFISNSHLMRHHRTHLVE                                     491 - 527
//

Text Mined References (12)

PMID Year Title