Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.02
PubTator Score 18.87

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 1.4e-04
glioblastoma 1.100 2.9e-05
group 3 medulloblastoma 1.500 1.8e-03
lung cancer 1.300 3.2e-02
malignant mesothelioma -5.300 8.3e-10
osteosarcoma -1.260 8.0e-03
ovarian cancer -1.300 4.4e-06
posterior fossa group B ependymoma 1.100 6.1e-05
primitive neuroectodermal tumor 1.100 1.6e-02
psoriasis -1.200 2.0e-07
spina bifida -1.205 4.9e-02
tuberculosis -1.400 4.2e-05

PDB (23)

Gene RIF (12)

AA Sequence

QRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH                                     911 - 947

Text Mined References (21)

PMID Year Title