Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.2e-08
ovarian cancer 8520 3.2e-06
tuberculosis 2010 8.3e-05
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.4
Breast cancer 3578 0.0 3.0
Lymphoid leukemia 160 0.0 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.836 2.2e-08
ovarian cancer -1.200 3.2e-06
tuberculosis -1.100 8.3e-05

Gene RIF (8)

AA Sequence

MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGHQPFHPFHFLREEKFWMMETAT      1 - 70
QREGNSGGKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPS     71 - 140
QNGKCKQSFSDVAIFDPPQQFHSGEKSHTCNECGKSFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSC    141 - 210
LQTRERVHTGEKPFKCEQCGKGFRCRAILQVHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPF    211 - 280
KCEICGKSFCLRSSLNRHCMVHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSY    281 - 350
LLIHQRIHSGEKPYRCEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPF    351 - 420
KCEDCGKRLVHRSFCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM                    421 - 474
//

Text Mined References (16)

PMID Year Title