Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.14
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.400 3.7e-18
Astrocytoma, Pilocytic 1.200 4.7e-08
atypical teratoid / rhabdoid tumor 1.400 3.2e-05
cystic fibrosis and chronic rhinosinusit... -1.114 1.5e-02
ependymoma 1.300 1.4e-09
glioblastoma 1.500 3.1e-04
group 3 medulloblastoma 1.600 2.8e-05
intraductal papillary-mucinous neoplasm ... -1.500 1.8e-02
malignant mesothelioma 1.500 8.3e-06
medulloblastoma, large-cell 1.200 8.8e-05
oligodendroglioma 1.400 6.6e-11
osteosarcoma 3.217 1.4e-08
ovarian cancer 2.200 2.2e-05
pancreatic cancer -1.100 3.8e-03
pediatric high grade glioma 1.100 3.4e-05
primary pancreatic ductal adenocarcinoma -1.303 4.2e-03
primitive neuroectodermal tumor 1.100 2.5e-03
psoriasis 1.900 2.5e-04

AA Sequence

MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTL      1 - 70
FQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQ     71 - 140
CDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPS    141 - 210
WKAGTGRKSVAGLR                                                            211 - 224
//

Text Mined References (15)

PMID Year Title