Property Summary

NCBI Gene PubMed Count 7
PubMed Score 16.83
PubTator Score 12.58

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Croup 12 4.52 2.3
Influenza 142 3.339 1.7
Bronchiolitis 9 3.034 1.5

AA Sequence

IHTGERPYQCSECGRVFNQNSHLIQHQKVHTR                                          631 - 662

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2115127 1990 Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Krüppel.
2014798 1991 Twenty-seven nonoverlapping zinc finger cDNAs from human T cells map to nine different chromosomes with apparent clustering.