Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.68
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 3.2e-04
Pick disease 1856 5.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 3.2e-04
Pick disease 1.200 5.8e-04

Gene RIF (1)

AA Sequence

MDSVAFEDVDVNFTQEEWALLDPSQKNLYRDVMWETMRNLASIGKKWKDQNIKDHYKHRGRNLRSHMLER      1 - 70
LYQTKDGSQRGGIFSQFANQNLSKKIPGVKLCESIVYGEVSMGQSSLNRHIKDHSGHEPKEYQEYGEKPD     71 - 140
TRNQCWKPFSSHHSFRTHEIIHTGEKLYDCKECGKTFFSLKRIRRHIITHSGYTPYKCKVCGKAFDYPSR    141 - 210
FRTHERSHTGEKPYECQECGKAFTCITSVRRHMIKHTGDGPYKCKVCGKPFHSLSSFQVHERIHTGEKPF    211 - 280
KCKQCGKAFSCSPTLRIHERTHTGEKPYECKQCGKAFSYLPSLRLHERIHTGEKPFVCKQCGKAFRSAST    281 - 350
FQIHERTHTGEKPYECKECGEAFSCIPSMRRHMIKHTGEGPYKCKVCGKPFHSLSPFRIHERTHTGEKPY    351 - 420
VCKHCGKAFVSSTSIRIHERTHTGEKPYECKQCGKAFSYLNSFRTHEMIHTGEKPFECKRCGKAFRSSSS    421 - 490
FRLHERTHTGQKPYHCKECGKAYSCRASFQRHMLTHAEDGPPYKCMWESL                        491 - 540
//

Text Mined References (14)

PMID Year Title