Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.35
PubTator Score 6.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.616 1.0e-02
psoriasis -1.500 8.5e-09
astrocytoma 1.200 1.5e-13
glioblastoma 1.800 8.7e-10
oligodendroglioma 1.300 1.1e-13
osteosarcoma -1.580 6.7e-07
chronic lymphosyte leukemia 1.300 6.0e-03
sonic hedgehog group medulloblastoma 1.900 1.7e-05
primitive neuroectodermal tumor 1.300 2.0e-03
intraductal papillary-mucinous adenoma (... 1.200 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.7e-02
lung cancer 1.100 9.3e-04
active Crohn's disease 1.011 4.8e-02
sarcoidosis 1.300 4.2e-03
cystic fibrosis 1.300 1.3e-03
pediatric high grade glioma 1.600 3.3e-06
pilocytic astrocytoma 1.300 5.2e-04
primary Sjogren syndrome 1.200 1.4e-02
aldosterone-producing adenoma -1.219 2.1e-02
invasive ductal carcinoma 1.100 3.3e-02
pituitary cancer 1.100 3.1e-03

AA Sequence

MVAKPPVMSFHFAQDLWPEQNIKDSFQKVTLRRYGKCEYENLQLRKGCKHVDECTGHKGGHNTVNQCLTA      1 - 70
TPSKIFQCNKYVKVFDKFSNSNRYKRRHTGNKHFKCKECSKSFCVLSQLTQHRRIHTRVNSYKCEECGKA     71 - 140
FNWFSTLTKHKRIHTGEKPYKCEECGKAFNQSSQLTRHKIIHTEEKPNKCEECGKAFKQASHLTIHKIIH    141 - 210
TGEKPYKYEECGKVFSQSSHLTTQKILHTGENLYKCKECGKAFNLFSNLTNHKRIHAGEKPYKCKECGRA    211 - 280
FNISSNLNKQEKIHTGGKLNKCEECDKAFNRSLKLTAHKKILMEEKPYKCEECGKVFNQFSTLTRHKIIH    281 - 350
TGEKPYKCKECGKAFNQSSNLTEHKKIHTAEKSYKCEECGKAFNQHSNLINHRKIYSGEKPYKCEECGKA    351 - 420
FNRSSTLTRHKKIHTGEKPYKCEECDRAFSQSSNLTEHKKIHTGEKPYKCEECGKAFNRFSTLTKHKRIH    421 - 490
TGEKPYKCEECGKAFNQSYQLTRHKIVHTKEKLNKCEEFGKAFKQSSHRTIHKIIHTGEKPYKCEEHGKV    491 - 560
FNQSSNLTTQKIIHTGENLYKFEEHGKAFNLFSNITNHKIIYTGEKPHKCEECGKAYNRFSNLTIHKRIH    561 - 630
TGEKPYQCAECGKAFNCSSTLNRHKIIHTGEKPYKCKECGKAFNLSSTLTAHKKIHTGEKPYKCEECGKA    631 - 700
FNQSSNLTTHKKIHTSEKPYKCEECGKSFNQFSSLNIHKIIHTGEKPYKCGDYGRAFNLSSNLTTHKKIH    701 - 770
TGEKPYKCEYGKT                                                             771 - 783
//

Text Mined References (7)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10673043 1999 Cloning and characterization of a novel human gene encoding a zinc finger protein with 25 fingers.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.