Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.429 4.5e-09
group 3 medulloblastoma 1.700 1.3e-04
tuberculosis and treatment for 6 months 1.100 5.7e-05
intraductal papillary-mucinous neoplasm ... 1.400 8.9e-04
sarcoidosis 1.100 1.8e-02
diabetes mellitus 1.800 4.9e-03
interstitial cystitis 1.400 6.6e-04
primary Sjogren syndrome 1.500 4.2e-03

AA Sequence

MDSVAFEDVAVNFTQEEWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSLVERL      1 - 70
CGRKEGNEHRETFSQIPDCHLNKKSQTGVKPCKCSVCGKVFLRHSFLDRHMRAHAGHKRSECGGEWRETP     71 - 140
RKQKQHGKASISPSSGARRTVTPTRKRPYECKVCGKAFNSPNLFQIHQRTHTGKRSYKCREIVRAFTVSS    141 - 210
FFRKHGKMHTGEKRYECKYCGKPIDYPSLFQIHVRTHTGEKPYKCKQCGKAFISAGYLRTHEIRSHALEK    211 - 280
SHQCQECGKKLSCSSSLHRHERTHSGGKLYECQKCAKVFRCPTSLQAHERAHTGERPYECNKCGKTFNYP    281 - 350
SCFRRHKKTHSGEKPYECTRCGKAFGWCSSLRRHEMTHTGEKPFDCKQCGKVFTFSNYLRLHERTHLAGR    351 - 420
SQCFGRRQGDHLSPGV                                                          421 - 436
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14727140 2004 A novel Krüppel-Associated Box identified in a panel of mammalian zinc finger proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.