Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.42
PubTator Score 3.70

Knowledge Summary


No data available



  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.234 3.0e-05
ovarian cancer 1.100 1.1e-06

Gene RIF (1)

15203203 ZIM2 gene, like the co-transcribed PEG3 gene, is imprinted in human, with preferential expression from the paternal allele. The imprinting status of ZIM2 is not conserved among mammals.

AA Sequence

ERPYQCQLCGKCFGRPSYLTQHYQLHSQEKTVECDHC                                     491 - 527

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203203 2004 Lineage-specific imprinting and evolution of the zinc-finger gene ZIM2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10708526 2000 Exon sharing of a novel human zinc-finger gene, ZIM2, and paternally expressed gene 3 (PEG3).