Property Summary

NCBI Gene PubMed Count 42
PubMed Score 80.21
PubTator Score 68.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.012 4.9e-02
Astrocytoma, Pilocytic -1.500 3.0e-02
atypical teratoid / rhabdoid tumor 1.700 7.9e-03
Breast cancer 1.400 2.8e-03
ependymoma 2.200 1.1e-07
glioblastoma -1.400 3.6e-02
group 4 medulloblastoma -2.400 8.7e-03
nasopharyngeal carcinoma 2.300 2.5e-06
non-small cell lung cancer 1.907 1.3e-11
psoriasis 1.100 1.1e-17
subependymal giant cell astrocytoma -5.742 2.7e-03

 GWAS Trait (1)

Gene RIF (31)

AA Sequence

MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAFKLNPGAHELS      1 - 70
PGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFLFRSRGFGDSAPGGGQHGLFG     71 - 140
PGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQL    141 - 210
HNQYGPMNMNMGMNMAAAAAHHHHHHHHHPGAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTM    211 - 280
HELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENL    281 - 350
KIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ    351 - 420
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSG    421 - 490
GGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV                                491 - 532
//

Text Mined References (43)

PMID Year Title