Property Summary

NCBI Gene PubMed Count 14
PubMed Score 45.63
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
colon cancer 1475 8.3e-06
primary pancreatic ductal adenocarcinoma 1271 2.9e-03
active ulcerative colitis 477 4.6e-03
Disease Target Count Z-score Confidence
Adenomyoma 1 3.972 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.176 2.9e-03
colon cancer -6.500 8.3e-06
active ulcerative colitis -2.470 4.6e-03

 GO Function (1)

 GO Process (1)

Gene RIF (4)

PMID Text
25919894 Pathogen-related glycan microarray analysis identified phosphatidylinositol mono- and di-mannosides (PIM1 and PIM2) as novel ligand candidates of ZG16p.
21893569 Human ZG16p recognizes pathogenic fungi through non-self polyvalent mannose in the digestive system.
21110947 the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site.
17307141 hZG16 was markedly down-regulated in hepatocellular carcinoma (HCC) as indicated by RT-PCR.

AA Sequence

MLTVALLALLCASASGNAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGK      1 - 70
VWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLR     71 - 140
FISGRSGSLIDAIGLHWDVYPSSCSRC                                               141 - 167
//

Text Mined References (16)

PMID Year Title
25919894 2015 Defining the Interaction of Human Soluble Lectin ZG16p and Mycobacterial Phosphatidylinositol Mannosides.
25416956 2014 A proteome-scale map of the human interactome network.
21893569 2012 Human ZG16p recognizes pathogenic fungi through non-self polyvalent mannose in the digestive system.
21110947 2011 Crystal structures of human secretory proteins ZG16p and ZG16b reveal a Jacalin-related ?-prism fold.
17307141 2007 hZG16, a novel human secreted protein expressed in liver, was down-regulated in hepatocellular carcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
7720729 1994 cDNA cloning and characterization of a novel 16 kDa protein located in zymogen granules of rat pancreas and goblet cells of the gut.