Property Summary

NCBI Gene PubMed Count 34
PubMed Score 122.89
PubTator Score 262.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.400 1.7e-08
osteosarcoma 1.530 5.7e-06
atypical teratoid / rhabdoid tumor -1.400 5.9e-06
glioblastoma -1.300 6.1e-05
medulloblastoma, large-cell -1.300 6.4e-04
primitive neuroectodermal tumor -1.100 3.6e-03
interstitial cystitis -1.200 9.7e-04
lung adenocarcinoma -1.500 9.3e-18
adult high grade glioma -1.200 3.9e-04

Gene RIF (16)

PMID Text
26358513 we have identified endofin as an important signalling component required for basal and BMP-induced hepcidin expression.
26159183 SARA may serve as a potential novel target in pre-Epithelial-mesenchymal transition states for the amelioration renal fibrosis seen in chronic kidney diseases
25614622 PI3K-C2a was also required for TGFb receptor-mediated formation of SARA-Smad2/3 complex
25496667 Genome-wide shRNA screening identifies ZFYVE9, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23222715 The negative influence that perturbation of RNF11 and SARA levels exerts on the lysosomal degradation of EGFRs could underscore the significance of overexpression of RNF11 in certain cancers.
22942286 TGF-beta1 can induce epithelial-to-mesenchymal transition through reduction in SARA expression, SARA is also basally regulated by its interaction with PI3K.
22819827 no correlation between SARA expression and the levels of TGF-beta1-induced phosphorylation of Smads in various B-cell lymphomas
21878490 SARA binds to ERBIN using a new domain, which we have called the ERBID (ERBIN-binding domain)
21200089 After stimulation with glucose, expression of SARA decreased in a time-dependent manner in epithelium to mesenchymal transition of proximal tubule cells.
19620243 SARA has a role in regulating cell phenotype and its effects are mediated through modification of the balance between Smad2 and Smad3 signaling
17693260 Protein-protein and protein-lipid interactions organized by SARA regulate the vesicular targeting of rhodopsin-bearing axonemal vesicles to nascent discs at the base of the rod outer segment.
17356069 SARA acts as a Smad anchor for receptor activation in BMP signaling.
15613484 internalization is important for transforming growth factor beta1-induced Smad2 association with Smad anchor for receptor activation (SARA) and Smad2-dependent signaling in human mesangial cells
15231848 SARA MH2 domains function in TGF-beta signaling
12432064 role in rab5 mediated endocytosis
11877415 Expression of a SARA mutant protein lacking the FYVE finger inhibits downstream activin A signaling in endothelial cells.

AA Sequence

MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESAVSNESQPQLK      1 - 70
VFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNYSWDDQCSAVEVGEKKCGNLA     71 - 140
CLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDAFSCSLDNENRQTDQFSFSINESTEKDMNSE    141 - 210
KQMDPLNRPKTEGRSVNHLCPTSSDSLASVCSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPA    211 - 280
VKKQENYIPDEDLTGKISSPRTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSG    281 - 350
RNNDCERCSDCLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE    351 - 420
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSF    421 - 490
VPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGDLMKKNYLHNFCSQVPSVLGQ    491 - 560
SSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQNDFPANSGNNTKNKNDILGKAKLGENSATN    561 - 630
VCSPSLGNISNVDTNGEHLESYEAEISTRPCLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDS    631 - 700
QAPNCMKCEARFTFTKRRHHCRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSAS    701 - 770
SQSPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV    771 - 840
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIPEDGLPPILIS    841 - 910
TGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNRKCWCFTTKGMHAVGQSEIVI    911 - 980
LLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPT    981 - 1050
PPYLFGILIQKWETPWAKVFPIRLMLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTL   1051 - 1120
PVVQGLVVDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISI   1121 - 1190
HNQPRKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP   1191 - 1260
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLENDDQHNCLSDPA   1261 - 1330
DHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSALVPVI   1331 - 1400
HGGACQLSEGPVVMELIFYILENIV                                                1401 - 1425
//

Text Mined References (39)

PMID Year Title
26358513 2015 Endofin, a novel BMP-SMAD regulator of the iron-regulatory hormone, hepcidin.
26159183 2015 Smad Anchor for Receptor Activation Regulates High Glucose-Induced EMT via Modulation of Smad2 and Smad3 Activities in Renal Tubular Epithelial Cells.
25614622 2015 Phosphatidylinositol 3-kinase class II ?-isoform PI3K-C2? is required for transforming growth factor ?-induced Smad signaling in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23222715 2013 SARA and RNF11 interact with each other and ESCRT-0 core proteins and regulate degradative EGFR trafficking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22942286 2012 Phosphatidylinositol 3-kinase and Rab5 GTPase inversely regulate the Smad anchor for receptor activation (SARA) protein independently of transforming growth factor-?1.
22819827 2012 SARA is dispensable for functional TGF-? signaling.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21878490 2011 ERBIN is a new SARA-interacting protein: competition between SARA and SMAD2 and SMAD3 for binding to ERBIN.
21266541 2011 Expression, purification, and functional characterization of recombinant PTD-SARA.
21200089 2010 [SARA expression in high glucose induced epithelium to mesenchymal transition of proximal tubule cells].
20515759 2010 Smad anchor for receptor activation (SARA) in TGF-beta signaling.
19620243 2009 Role of SARA (SMAD anchor for receptor activation) in maintenance of epithelial cell phenotype.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18511908 2008 Identification of PCTA, a TGIF antagonist that promotes PML function in TGF-beta signalling.
17693260 2007 SARA-regulated vesicular targeting underlies formation of the light-sensing organelle in mammalian rods.
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
16775010 2006 Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15613484 2005 The role of internalization in transforming growth factor beta1-induced Smad2 association with Smad anchor for receptor activation (SARA) and Smad2-dependent signaling in human mesangial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356634 2004 Cytoplasmic PML function in TGF-beta signalling.
15231848 2004 Disorder in a target for the smad2 mad homology 2 domain and its implications for binding and specificity.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14759258 2004 An unappreciated role for RNA surveillance.
12809483 2003 ST7 is a novel low-density lipoprotein receptor-related protein (LRP) with a cytoplasmic tail that interacts with proteins related to signal transduction pathways.
12554698 2003 SARA and Hgs attenuate susceptibility to TGF-beta1-mediated T cell suppression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432064 2002 SARA, a FYVE domain protein, affects Rab5-mediated endocytosis.
12154125 2002 Smad3 allostery links TGF-beta receptor kinase activation to transcriptional control.
11918675 2002 The FYVE domain in Smad anchor for receptor activation (SARA) is sufficient for localization of SARA in early endosomes and regulates TGF-beta/Smad signalling.
11877415 2002 Early endosomal regulation of Smad-dependent signaling in endothelial cells.
11100470 2001 Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.
10615055 2000 Structural basis of Smad2 recognition by the Smad anchor for receptor activation.
9865696 1998 SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.
9582421 1998 Identification of a novel serine protease-like molecule in human brain.