Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
glioblastoma 5572 3.4e-06
ovarian cancer 8491 1.9e-04
medulloblastoma, large-cell 6234 5.3e-04
oligodendroglioma 2849 1.6e-03
osteosarcoma 7933 3.4e-03
ependymoma 2514 4.8e-03

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 4.8e-03
oligodendroglioma 1.200 1.6e-03
osteosarcoma 1.237 3.4e-03
glioblastoma -1.200 3.4e-06
medulloblastoma, large-cell -1.100 5.3e-04
ovarian cancer -1.400 1.9e-04

AA Sequence

MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKD      1 - 70
DFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTGE     71 - 140
KPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP                141 - 198
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
1397691 1992 Expression of a mouse zinc finger protein gene in both spermatocytes and oocytes during meiosis.