Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.38
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.165 1.8e-02
cystic fibrosis -1.449 6.8e-05
ependymoma 1.600 1.2e-02
gastric cancer 1.200 3.3e-03
hepatocellular carcinoma 1.600 1.5e-06
osteosarcoma -1.072 1.9e-03
tuberculosis and treatment for 6 months -1.200 8.1e-04

AA Sequence

MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFP      1 - 70
SGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKP     71 - 140
HTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSS    141 - 210
HLIHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERY    211 - 280
HECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNS    281 - 350
EIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKP    351 - 420
HQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSS    421 - 490
HLLRHQSVHCME                                                              491 - 502
//

Text Mined References (5)

PMID Year Title