Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.36
PubTator Score 0.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.200 3.3e-03
hepatocellular carcinoma 1.600 1.5e-06
ependymoma 1.600 1.2e-02
osteosarcoma -1.072 1.9e-03
cystic fibrosis -1.449 6.8e-05
tuberculosis and treatment for 6 months -1.200 8.1e-04
ulcerative colitis -1.200 1.3e-06

AA Sequence

MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQGHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFP      1 - 70
SGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTEGVSAFATSGQNFLEILESNKTQRSSVGEKP     71 - 140
HTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSS    141 - 210
HLIHHHRIHTGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERY    211 - 280
HECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNS    281 - 350
EIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKP    351 - 420
HQCNECARTFWDNSELLLHQKIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSS    421 - 490
HLLRHQSVHCME                                                              491 - 502
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.