Property Summary

NCBI Gene PubMed Count 5
PubMed Score 17.28
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.200 8.1e-05
intraductal papillary-mucinous carcinoma... -1.200 7.6e-05
intraductal papillary-mucinous neoplasm ... -1.200 3.8e-04
osteosarcoma 1.406 2.3e-07
psoriasis -1.100 6.7e-45

PDB (13)

Gene RIF (2)

AA Sequence

MRGAASASVREPTPLPGRGAPRTKPRAGRGPTVGTPATLALPARGRPRSRNGLASKGQRGAAPTGPGHRA      1 - 70
LPSRDTALPQERNKKLEAVGTGIEPKAMSQGLVTFGDVAVDFSQEEWEWLNPIQRNLYRKVMLENYRNLA     71 - 140
SLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKAVWKIKELPLKKDFCEGKLSQAVITERLTSYNL    141 - 210
EYSLLGEHWDYDALFETQPGLVTIKNLAVDFRQQLHPAQKNFCKNGIWENNSDLGSAGHCVAKPDLVSLL    211 - 280
EQEKEPWMVKRELTGSLFSGQRSVHETQELFPKQDSYAEGVTDRTSNTKLDCSSFRENWDSDYVFGRKLA    281 - 350
VGQETQFRQEPITHNKTLSKERERTYNKSGRWFYLDDSEEKVHNRDSIKNFQKSSVVIKQTGIYAGKKLF    351 - 420
KCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHTGKKPYECIECGKAFIQNTS    421 - 490
LIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHKSFRYGSSLTVHQRIHTGEKP    491 - 560
YECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHLRIHTGEKPFECAECGKSFSISS    561 - 630
QLATHQRIHTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKP    631 - 700
YKCMECGKAFGDNSSCTQHQRLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSVCGKAFSHRQ    701 - 770
SLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS    771 - 840
TCPSLPSTSNPVDLFPKFLWNPSSLPSP                                              841 - 868
//

Text Mined References (6)

PMID Year Title