Property Summary

NCBI Gene PubMed Count 239
PubMed Score 560.75
PubTator Score 358.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 5.505 2.8
Posterior polymorphous corneal dystrophy 24 5.46 2.7

Expression

  Differential Expression (35)

Disease log2 FC p
astrocytic glioma 2.100 8.9e-03
oligodendroglioma 2.300 5.3e-03
psoriasis -1.300 1.5e-08
osteosarcoma 3.518 4.1e-08
ependymoma 1.800 1.4e-05
glioblastoma 1.700 2.0e-02
sonic hedgehog group medulloblastoma 2.900 2.5e-04
cystic fibrosis 1.148 1.1e-03
medulloblastoma, large-cell 1.900 1.3e-04
primitive neuroectodermal tumor 1.300 1.9e-02
autosomal dominant Emery-Dreifuss muscul... -1.190 3.6e-02
hereditary spastic paraplegia -1.182 3.2e-03
juvenile dermatomyositis 1.170 1.3e-05
tuberculosis -2.100 2.8e-07
primary pancreatic ductal adenocarcinoma 2.132 1.4e-02
non-small cell lung cancer -1.106 2.6e-09
intraductal papillary-mucinous adenoma (... -2.100 1.0e-02
intraductal papillary-mucinous carcinoma... -3.100 2.0e-03
intraductal papillary-mucinous neoplasm ... -2.200 2.8e-02
colon cancer -2.400 2.1e-05
lung cancer -1.700 1.2e-04
lung adenocarcinoma -1.100 1.2e-09
pediatric high grade glioma 2.100 4.0e-03
pilocytic astrocytoma 2.300 6.2e-05
primary Sjogren syndrome 1.300 1.5e-04
aldosterone-producing adenoma -1.063 1.7e-02
subependymal giant cell astrocytoma 1.668 3.6e-02
Breast cancer 1.600 1.5e-05
gastric carcinoma 1.300 3.0e-02
ductal carcinoma in situ -1.200 1.1e-02
invasive ductal carcinoma -2.000 2.0e-04
ulcerative colitis 1.900 1.1e-04
ovarian cancer -3.700 5.2e-09
Gaucher disease type 3 -1.100 1.0e-02
pancreatic cancer 1.900 3.8e-03

Gene RIF (221)

PMID Text
26940738 expression of ZEB1 and TWIST1, which are master regulators of tumor metastasis. Our study first indicates that miR-1271 functions as a suppressor in regulating of pancreatic cancer EMT by targeting ZEB1 and TWIST1.
26898939 Results indicate that linc-ROR acts as an important regulator of ZEB1, can promote invasion and metastasis in pancreatic cancer.
26882471 Collectively, we found that ZEB1-expressing breast cancer cells increase VEGFA production and thus stimulate tumor growth and angiogenesis via a paracrine mechanism.
26876920 A direct interaction of ZEB1 with the Hippo pathway effector YAP, in which ZEB1 switches its function to a transcriptional co-activator of a 'common ZEB1/YAP target gene set', links two pathways with similar cancer promoting effects.
26823172 suggest that deltaEF1 family proteins promote cell motility of breast cancer cells directly or indirectly through repressing expression of RGS16
26717907 SET8 and ZEB1 are functionally interdependent in promoting the epithelial-mesenchymal transition and enhancing the invasive potential of prostate cancer cells in vitro.
26622166 ZEB1 mutations and TCF4 rs613872 changes are associated with late onset Fuchs endothelial corneal dystrophy in patients from Northern India.
26619383 we report posterior polymorphous corneal dystrophy resulting from a de novo mutation in ZEB1. Additionally, we present a congenital hereditary endothelial dystrophy case with a thin Descemet membrane with a novel compound heterozygous SLC4A11 mutation.
26617850 The upregulation of ZEB1 is associated with the abnormal expression of E-cadherin, beta-catenin and N-cadherin, which might promote the progression and metastasis of cervical squamous cell carcinoma.
26556542 Our study first indicates that miR-590-3p functions as a suppressor of GBM EMT and metastasis by targeting ZEB1 and ZEB2, and it may be a therapeutic target for metastatic GBM.
26551670 ZEB1 gene deletion is associated with Sezary syndrome.
26547370 Immunohistochemistry revealed ZEB1 expression in the cytoplasm, in nuclei and in tumor stroma of esophageal squamous cell carcinoma. In primary small-cell carcinoma of the esophagus only nuclear staining was observed.
26546081 identified Zinc finger E-box-binding homeobox 1 (ZEB1) bond to FBP1 promoter to enhance DNA methylation in lung cancer cells. Our findings indicate that the down-regulation of FBP1 is a critical oncogenic event in lung cancer progression
26540342 Data show that telomerase (hTERT) and ZEB1 protein form a complex, which directly binds to the E-cadherin promoter, and then inhibits E-cadherin expression and promotes epithelial-to-mesenchymal transition (EMT) in colorectal cancer cells.
26514226 HOXD9 promotes epithelial-mesenchymal transition and cancer metastasis by ZEB1 regulation in hepatocellular carcinoma
26498682 Data show that microRNA miR-652 was decreased in pancreatic cancer (PC) tissues and antagonistically correlated with zinc finger E-box binding homeobox 1 protein (ZEB1) expression, associating with late tumor stage.
26387539 Results provides evidence that TCF4 and ZEB1 modulate each other's transcriptional activity in the regulation of tumor pro-invasive Wnt target genes.
26334100 TKS5 and MYLK represent two mediators of invasive behavior of cancer cells that are regulated by the ZEB1/miR-200 feedback loop
26321866 The downregulation of ZEB1, Twist1, and Snail1 reduces the invasive properties of uveal melanoma cells, and the elevated mRNA levels of ZEB1 and Twist1 are associated with a more aggressive clinical phenotype in uveal melanoma samples.
26302187 findings suggest that increased expression levels of ZEB1 and Snail1 in FECD cells were responsible for an increased responsiveness to TGF-beta present in the aqueous humor and excessive production of ECM
26297948 this regard, we have demonstrated that PEAK1 is necessary for TGFbeta to induce ZEB1-mediated EMT in the context of fibronectin/ITGB3 activation.
26275944 MiR-205, acting as an oncogenic miRNA, may promote the clinical progression of epithelial ovarian cancer patients and enhance the cellular motility in vitro by directly and negatively regulating ZEB1.
26264186 emphasize the key role of ZEB1 in EMT in cultured BCD cells and support the value of ZEB1 inhibition for BCD cell redifferentiation and generation of functional human beta-like cells for cell therapy of diabetes
26191328 miR-144 promotes the apoptosis of lung cancer cells, and inhibits the proliferation, invasion and migration of lung cancer by regulating ZEB1 gene.
26170011 ZEB1 expression can serve as a potential biomarker to define a subgroup of triple negative breast tumors associated with poor clinical outcomes.
26077342 Employs CD44s to activate ZEB1 expression.
26073087 results provide novel insights into the function of lncRNA-driven hepatocarcinogenesis, highlight the important role of ZEB1-AS1 and ZEB1 in HCC progression, and indicate that ZEB1-AS1 may be served as a valuable prognostic biomarker for HCC
26057751 ZEB1 is a direct downstream of HIF-1alpha, suggesting a novel molecular mechanism for HIF-1alpha-inducing epithelial-mesenchymal transition and cancer metastasis.
26043676 The results showed that BMI1 and ZEB1 are important factors in association with the promotion of EMT and invasion of tongue squamous cell carcinoma
26022123 miR-139-5p expression is downregulated in hepatocarcinoma tissues and cell lines. miR-139-5p inhibits ZEB1 and ZEB2 expression.
26011542 53BP1 functioned as a tumor suppressor gene by its novel negative control of Epithelial-mesenchymal transition through regulating the expression of miR-200b/429 and their target gene ZEB1.
25989272 tumour-budding cells express EMT hallmarks at protein and mRNA levels underlining their EMT-type character and are surrounded by stromal cells expressing high levels of the E-cadherin repressors ZEB1, ZEB2 and SNAIL1
25986864 High ZEB1 levels were associated with Gastric Cancer.
25963537 Down-regulation of ZEB1 expression may protect the invasive front of the tumors from converting to a mesenchymal phenotype by reducing the proliferation and motility of cervical cancer cells.
25950745 Our results correlated ZEB1 with aggressive potentials of breast carcinoma and revealed a possibility for ZEB1 as a prognostic marker in breast carcinoma
25921099 miR-128 functions as a potential cancer suppressor in prostate cancer progression and rational therapeutic strategies could be developed based on miR-128/zinc-finger E-box-binding homeobox 1 axis.
25910959 CRTAM is negatively regulated by ZEB1 in T cells.
25896413 MiR-10b directly targets the 3'-UTRs of ZEB1 and PIK3CA.
25890268 The ZEB1-CA9 signaling axis as a biomarker of poor prognosis in tongue cancer.
25880398 Results provide evidence of an Rb1-dependent Ets1-Zeb1 amplification loop in thymocytes differentiation and tumor invasion.
25868853 targeting miRNA by cordycepin indicates a new mechanism of cordycepin-induced suppression of tumor metastasis; miR-33b/HMGA2/Twist1/ZEB1 axis plays critical roles in regulating melanoma dissemination
25833697 MiR-139-5p specifically interacts with the 3'-UTR regions of ZEB1 and ZEB2, attenuating their expression in glioblastoma multiforme cells.
25808945 ectopic expression of miR-101 can significantly downregulate ZEB1 in the hepatocyte and thereby reduces the mesenchymal marker expression
25738863 These results suggest that acquirement of epoxomicin-resistance in endometrial carcinoma Ishikawa cells with epoxomicin cells induces up regulation of ZEB1 via suppression of the miR-200 family following suppression of E-cadherin.
25640197 MiR-429 inhibits oral squamous cell carcinoma growth by targeting ZEB1
25592037 HIF1alpha-ZEB1 signaling axis promotes hypoxia induced mesenchymal shift and invasion in glioblastoma cells.
25544793 ZEB1 expressions were significantly associated with subtype, grade, myometrial invasion, and lymph node metastases in endometrial neoplasia.
25528765 Data indicate that ubiquitin ligase Siah as a regulator of to Mesenchymal Transition (EMT) by controlling the abundance of the key transcription factor Zeb1, while Siah itself is subject to regulation by EMT-inducing factors.
25521330 Results support the role for ZEB1 in invasive and high-grade brain tumors and suggest its key role in promoting invasion in the hypoxic tumor core as well as in the periphery
25479687 ZEB1 may be used as an immunohistochemical prognosticator of PC, which may be useful for histological assessment of PC in biopsy and surgical specimens.
25476932 MiR-205 inhibits DNA damage repair by targeting ZEB1 and Ubc13.
25455932 LARGE2 is negatively regulated by Snail and/or ZEB1, revealing a mechanistic basis for alphaDG hypoglycosylation during prostate cancer progression and metastasis.
25441224 we report six novel ZEB1 mutations causing posterior polymorphous corneal dystrophy 3
25422078 our findings in this study suggest that PZH can inhibit metastasis of colorectal cancer cells via modulating TGF-beta1/ZEB/miR-200 signaling network, which might be one of the mechanisms whereby PZH exerts its anticancer function
25405387 We identified ZEB1 and CRKL as potential targets of miR-429 by analyzing combined results from in silico search and global expression array of the same RNA samples. Immunoblot assay confirmed that miR-429 reduced their expression at protein level.
25348003 ZEB1, an epithelial-to-mesenchymal transition activator and transcriptional repressor of miR-200, relieves miR-200 repression of PD-L1 on tumour cells.
25347933 The expression of ZEB1 correlated with an undifferentiated and/or sarcomatoid morphology that may occur in the late stage of epithelial-mesenchymal transition
25344754 ASPP2 prevents beta-catenin from transactivating ZEB1 directly by forming an ASPP2-beta-catenin-E-cadherin ternary complex
25315069 deltaEF1 associates with DNMT1 and maintains DNA methylation of the E-cadherin promoter in breast cancer cells.
25301070 Fra-1 induces critical changes in the expression of tgfb1 and Epithelial-to-mesenchymal transition transcription factors through direct binding to the tgfb1, zeb1 and zeb2 genomic regulatory regions.
25275602 TGF-beta induced ZEB1-dependent mesenchymal transdifferentiation in glioblastoma that is associated with tumor invasion.
25270213 Data suggest that beta-catenin and ZEB1 protein can be simultaneously used as candidate targets for early diagnosis and prognosis prediction in bladder cancer.
25261470 MicroRNA-141 and microRNA-146b-5p have a role in inhibiting the prometastatic mesenchymal characteristics through the RNA-binding protein AUF1 targeting the transcription factor ZEB1 and the protein kinase AKT
25190660 ZEB1 truncating mutations result in a significant decrease and/or impaired nuclear localization of the encoded protein, indicating that ZEB1 haploinsufficiency in PPCD3 may result from decreased protein production and/or impaired cellular localization
25178837 A significant correlation between expression of Snail1, Snail2 and Zeb1 with miR-200f repression and CpG miR-200c-141 promoter methylation was detected in endometrial carcinosarcomas.
25160502 Data show the presence of androgen receptor elements regulates ZEB1 expression in the absence of androgen receptor
25155634 found an inverse correlation between ZEB1 and DDR1 expression in various cancer cell lines and in human breast carcinoma tissues
25142232 Overexpression of zinc finger E-box binding homeobox factor 1 promotes tumor invasiveness and confers unfavorable prognosis in esophageal squamous cell carcinoma.
25119590 Upregulation in ZEB1 is associated with ovarian cancer cell invasion.
25090005 miR-150 may function as a tumor suppressor and modulate epithelial ovarian cancer cell proliferation, and invasion by directly and negatively regulating ZEB1.
25086746 ZEB1 is an ATM substrate linking ATM to CHK1 and the mechanism underlying the association between epithelial-mesenchymal transition and radioresistance.
25043300 An inverse correlation between CD117 or ZEB1 and DAB2IP is also found in clinical specimens.
24968735 restoration of miR-144 in K1 and WRO thyroid cancer cells suppressed invasion and migration capability of these cells; miR-144 also suppressed expression of ZEB1 and ZEB2, two E-cadherin suppressors, by directly binding to their 3'-untranslated regions.
24929761 Data suggest that ZEB1 expression in cancer cells and stromal fibroblasts are strong prognostic factors in pancreatic ductal adenocarcinoma (PDAC). Stromal ZEB1 expression is an independent predictor of survival after resection of PDAC.
24762440 ZEB1 sensitizes lung adenocarcinoma cells to metastasis suppression by PI3K-targeted therapy
24756066 has identified ZEB1 as a target of GRHL2 and suggested a reciprocal GRHL2-ZEB1 repressive relationship, providing a novel mechanism through which proliferation may be modulated in colorectal cancer cells.
24643400 The knockdown of ZEB1 promoted nuclear re-expression of E-cadherin, reduced expression of vimentin, N-cadherin, and BIRC5 genes, and reduced cell migration.
24615544 Study investigated nested regulatory circuits of miR-200c/ZEB1 and miR-200c/ZNF217/TGF-beta/ZEB1 in synergistically promoting trastuzumab resistance and metastasis of breast cancer cells.
24577090 These results indicate BAG3 as a regulator of ZEB1 expression in epithelial-mesenchymal transition and as a regulator of metastasis in thyroid cancer cells.
24573236 our results indicate that miR-1236-3p regulates ovarian cancer metastasis by directly targeting ZEB1
24468793 TBK1 signaling regulates radiation-induced epithelial-mesenchymal transition by controlling GSK-3beta phosphorylation and ZEB1 expression.
24400868 Our data suggest that ZEB1 may participate in the pathogenesis of areca quid-associated OSF by activating the alpha-SMA promoter and inducing myofibroblast transdifferentiation from BMFs.
24390222 inhibition of ZEB1 by miR-200, with secondary increase in BCL6, is a molecular event that characterizes H. pylori-positive gastric diffuse large B-cell lymphomas with a less aggressive behavior.
24348007 Variation in the COL8A2, SLC4A11, and ZEB1 genes is present in only a small fraction of African American cases and as such does not appear to significantly contribute to the genetic risk of Fuchs endothelial corneal dystrophy.
24306957 ZEB1/ZEB2 and miRNAs expression seems to reliably distinguish between different grades of papillary urothelial tumors of the urinary bladder
24305877 CUL4A has a pivotal role in regulating the metastatic behavior of breast cancer cells in a process involving ZEB1
24304617 Positive ZEB-1 expression and loss of E-cadherin expression are correlated with poor prognosis in hepatocellular carcinoma patients.
24304426 twist and zeb1 are involved in placental maturation, whereas claudin 4 appears to be connected with placental diseases such as diabetes, toxaemia or molar disease.
24283570 Direct repression of MYB by ZEB1 suppresses proliferation and epithelial gene expression during epithelial-to-mesenchymal transition of breast cancer cells.
24277930 Data indicate that p21 forms a complex with ZEB1 at the miR-183-96-182 cluster promoter to inhibit transcriptional repression of this cluster by ZEB1, suggesting a reciprocal feedback loop.
24257549 Down-regulation results in an inhibitory effect on the invasive and metastatic potential of epithelial ovarian cancer in vitro and in vivo by blocking the epithelial-mesenchymal transition process
24165969 ZEB1 and ZEB2 have been shown to induce epithelial-to-mesenchymal transition.
24154725 miR-200/ZEB forms a tristable circuit that acts as a ternary switch, driven by miR-34/SNAIL, that is a monostable module that acts as a noise-buffering integrator of internal and external signals.
24127332 ZEB1 up-regulation is associated with metastatic medullary thyroid carcinoma.
24113819 Abnormally steep corneal curvatures are identified in 37% of all individuals with posterior polymorphous corneal dystrophy (PPCD) and 86% of affected individuals with PPCD secondary to ZEB1 mutations.
24067373 Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation in breast cancer cells.
23994666 Up-regulation of ZEB1 is associated with oral sub-mucous fibrosis.
23957009 MRNAs of PTPN12, MSH6, and ZEB1 orthologous genes from different animal species have binding sites for hsa-miR-1279 which consist of homologous oligonucleotides encoding similar human oligopeptides
23890107 GLI2 represses E-cadherin gene (CDH1) expression in melanoma cells via distinct mechanisms, enhancing transcription of the EMT-activator ZEB1.
23869586 ZEB1 silencing also reduced beta-tubulin isotype classes I, III, and IVB mRNA, whereas upregulation of ZEB1 was associated with increases in these isotype classes
23844063 MicroRNA-23b functions as a tumor suppressor by regulating Zeb1 in bladder cancer.
23827675 Study demonstrates that non-cancer stem cells (CSCs) of human basal breast cancers are plastic cell populations that readily switch from a non-CSC to CSC state. The observed cell plasticity is dependent on ZEB1, a key regulator of the epithelial-mesenchymal transition.
23818228 ZEB1 has a role in glioblastoma initiation, invasion and chemoresistance
23807282 Nucleotide changes within the coding region of ZEB1 underlie the pathogenesis of posterior polymorphous corneal dystrophy 3(PPCD) in 4 of 23 Czech probands (17%).
23791009 The nuclear protein expression levels of SNAI1 and ZEB1 are involved in the progression and lymph node metastasis of cervical cancer via the epithelial-mesenchymal transition pathway.
23765923 miR-150 and miR-200c play an important role in human endothelial lineage specification and chick embryonic vasculogenesis by targeting ZEB1.
23743934 Suggest that ZEB1 overexpression, associated with E-cadherin and miR-200s downregulation, and the expression of mesenchymal markers might enhance the metastatic potential of undifferentiated endometrial carcinomas.
23690952 ZEB1 and TGFBR2 identified as direct targets of miR-655
23667256 Zeb1 proteins employ several evolutionary conserved mechanisms to regulate cell-cell adhesion during development and cancer
23599324 Missense substitutions in the ZEB1 protein are associated with FECD6 and keratoconus, whereas protein truncating ZEB1 mutations result in PPCD3.
23591815 Zeb1 is regulated by the Arf GTPase-activating protein (GAP) Git2.
23584475 Findings indicate that (i) MUC1-C activates ZEB1 and suppresses miR-200c with the induction of EMT and (ii) targeting MUC1-C could be an effective approach for the treatment of breast and possibly other types of cancers that develop EMT properties.
23565224 Helicobacter pylori initiates a mesenchymal transition through ZEB1 in gastric epithelial cells.
23559851 Five novel frame-shift mutations, one confirmed as spontaneous, in the ZEB1 gene associated with posterior polymorphous corneal dystrophy, are reported.
23412770 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23381389 We found upregulated miR-200a expression to increase E-cadherin and suppress the Wnt/beta-catenin pathway by targeting ZEB1 and ZEB2 in GA, thus delaying tumor growth in vivo.
23358160 A region-based analysis summarizing independent signals in segments of 100 kb identified a new region-based genome-wide significant locus overlapping the gene ZEB1.
23318438 ZEB1/2 upregulation by WASF3 results from downregulation of KISS1, leading to the release of inhibition of nuclear factor (NF)kappaB by IkappaBalpha
23285017 The expression of deltaEF1 is up-regulated by 17beta-estradiol (E2) in MCF-7 cells in an ER-alpha-dependent manner.
23255418 Ectopic expression of ZEB1 increases the chemoresistance of SPC-A1 cells to docetaxel.
23190132 In diffuse large B-cell lymphoma, cytoplasmic Slug expression was linked to a favourable disease outcome, whereas nuclear expression of ZEB1 indicated an adverse outcome.
23065281 Overexpression of the ZEB1 gene is possibly associated with the occurrence, development, invasion of lung squamous cell carcinoma.
23038259 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23030626 Metastatic adenocarcinomas show a higher expression of zeb1 and twist than primary lung tumors, confirming previous findings and highlighting their significance in the metastatic process.
23013135 data indicate that downregulated-miR-150 is associated with poor prognosis and cancer progression in esophageal squamous cell carcinoma (ESCC); epithelial-mesenchymal-transition (EMT)-inducer ZEB1 is regulated by miR-150, which may function as a regulator of EMT and MET in ESCC
22892238 levels of ZEB1 expression were low in local lesions but high in metastatic lymph nodes in HNC tissues. Patients with tumors that co-expressed ZEB1(high) and ZEB2(high) had especially poor survival rates.
22850877 ZEB1 controls the expression of numerous oncogenic and tumor-suppressive miRs, including miR-34a
22847613 These data provide a novel understanding of the roles of p53 gain-of-function mutations in accelerating tumor progression and metastasis through modulation of the miR-130b-ZEB1 axis.
22820858 Invasiveness was significantly correlated to the increased Zeb1 in tumour cells, as well as to increased ASMA, S100A4, and PDGFRbeta in stromal cells.
22685266 Altered expression of miR-200c may have a significant impact on the outcome of leiomyomas growth, maintenance of their mesenchymal and fibrotic characteristics, and possibly their associated symptoms.
22652173 In title.
22481253 Data suggest that knockdown of ZEB-1 expression by lentivirus-delivered siRNA may provide a novel therapeutic target for the treatment of lung cancer.
22466758 overexpression of ZEB1 may be related to the occurrence and development as well as invasion and metastasis of gastric adenocarcinoma.
22391641 Androgen receptor is overexpressed in boys with severe hypospadias, and ZEB1 regulates androgen receptor expression in human foreskin cells
22286765 SIX1 overexpression contributes to epithelial-mesenchymal transition partly through repression of miR-200-family expression and activation of ZEB1 in colorectal cancer.
22262832 RB inactivation contributes to tumor progression not only through loss of cell cycle control but also through up-regulation of ZEB expression and induction of an invasive phenotype.
22213144 In primary pancreatic tumors and metastatic lymph nodes, high and low expression of ZEB-1 and ZEB-2 was associated with mesenchymal and epithelial phenotype of cancer cells, respectively.
22213004 Overexpression of ZEB1 is associated with metastasis and invasion in osteosarcoma.
22212097 our results suggest that ZEB1 can promote VM formation by inducing EMT in CRC and might represent an important target in CRC.
22205962 E-cadherin could be upregulated by the suppression of ZEB1 transcriptional repressor by miRNAs in vivo
22205702 the roles of STAT3 in colorectal cancer epithelial-mesenchymal transition and in STAT3-induced down-regulation of E-cadherin
22199242 ZEB1-mediated alterations in COL4A3 expression are most likely associated with the pathogenesis of this corneal endothelial dystrophy.
22162761 C-peptide increases Na,K-ATPase expression via PKC- and MAP kinase-dependent activation of transcription factor ZEB in human renal tubular cells
22095522 Expression of the ZEB1 gene was significantly higher in cancerous tissue than in adjacent normal mucosa. Increased ZEB1 expression was significantly associated with peritoneal dissemination, and was an independent prognostic factor.
22086445 transient knockdown of ZEB1 expression with RNA interference in four malignant pleural mesothelioma cell lines dramatically suppressed their in vitro growth.
22080605 beta-catenin/TCF4 complex induces the epithelial-to-mesenchymal transition (EMT)-activator ZEB1 to regulate tumor invasiveness.
21955614 Data show that miR-200-regulated ZEB1 is reduced in LY2 cells.
21890822 ZEB1 is located on the invasive fronts exhibiting downregulation of the miR-200 family.TGF-beta induced ZEB1, reinforcing its role in epithelial-mesenchymal transition. ZEB1 knockdown prevented TGF-beta from inducing spindle-shaped cells & suppressing CDH1
21791114 Inhibition of ZEB1 may improve adenovirus uptake of cancer cells that have undergone EMT and for which ZEB1 is necessary to maintain the mesenchymal phenotype.
21747944 direct binding of TMPRSS2/ERG to the promoter of ZEB1 but not ZEB2
21717425 ZEB1 was confirmed as a key mediator of the latent-lytic switch of EBV-associated gastric cancer, a distinct subtype with different clinicopathologic features.
21643654 Snail and Zeb1 were sufficient to induce epithelial to mesenchymal transition (EMT) in the cells, but activated TGFbeta induced a more complex EMT, in which changes in extracellular matrix remodeling components were pronounced.
21593765 transcriptional activity of ZEB1 is increased by Slug, suggesting a hierarchical organized expression of epithelial mesenchyme transition (EMT) transcription factors through directed activation, triggering an EMT-like process in melanoma
21584833 This study shows that ZEB1 high expression was correlated with hepatocellular carcinoma malignant progression and subsequent poor patient survival by induction of EMT changes.
21527937 ZEB1 knockdown recapitulated miR-200c-induced responses, and expression of a ZEB1 allele non-targeted by miR-200c, prevented miR-200c phenotype.
21525039 Data define a pathway in which CCN6 attenuates IGF-1 signaling to decrease ZEB1 expression and invasion in breast cancer.
21518799 p53 regulates epithelial-mesenchymal transition through microRNAs targeting ZEB1 and ZEB2
21411626 demonstrated the existence of an autocrine TGF-beta/ZEB/miR-200 signaling network that regulates plasticity between epithelial and mesenchymal states.
21324165 Expression of transcriptional factors zeb1 and twist mainly occur in the stromal compartment of breast carcinomas.
21317430 The results indicate that Snail1 controls Zeb1 expression at multiple levels and acts cooperatively with Twist in the ZEB1 gene transcription induction.
21315410 Collectively, our studies demonstrate frequent expression of nuclear Snail1, but not nuclear ZEB1, in invasive, triple-negative breast cancers as well as in intraductal carcinomas.
21241837 deltaEF1 remarkably up-regulates matrix metalloproteinase-1 (MMP-1) expression at both mRNA and protein levels in MDA-MB-231 cells.
21224848 The ZEB1/miR-200 feedback loop controls Notch signalling in cancer cells.
21079000 These findings implicate the miR-200 family and their targets, ZEB1 and ZEB2, as unique regulators of uterine quiescence and contractility during pregnancy and labor.
21067486 The phenotype associated with changes in the ZEB1 gene exhibits variable expression and incomplete penetrance and seems to have a low risk for secondary glaucoma.
20980099 ZEB1 and ZEB2 are key regulators of the The epithelial to mesenchymal transition (EMT) process in non-small cell lung cancer.
20970163 down-regulation of ZEB1 seems to play a role in tumor spread, metastases, and poor survival in invasive ductal carcinomas of the breast.
20731704 ectopically expressed LMO2 impaired the function of DeltaEF1 in both transcriptional and protein levels and identified DeltaEF1 as a novel pathogenic target of LMO2 in T-cell leukemia.
20729552 ZEB1 coordinately regulates laminin-332 and {beta}4 integrin expression altering the invasive phenotype of prostate cancer cells
20514018 both ZEB1 downregulation and Smad7 overexpression contribute to resistance to TGF-beta1-mediated growth suppression in adult T-cell leukemia/lymphoma.
20452118 *Inhibiting ZEB1 function may be an attractive target for non-small cell lung cancer therapeutic development.
20424117 Increased levels of ZEB1 is associated with esophageal neoplasms.
20418909 ZEB1/BRG1 as a new transcriptional mechanism regulating E-cadherin expression and epithelial-to-mesenchymal transdifferentiation
20375168 Knockdown of ZEB2, but not ZEB1, led to Epstein-Barr virus lytic reactivation.
20175752 Results suggest that regulation of ZEB1 is required for control of BCL6 expression.
20036349 TCF8 missense mutations cause late-onset Fuchs corneal dystrophy and interact with FCD4 on chromosome 9p
19997581 ZEB1 mutations may account for posterior polymorphous corneal dystrophy in 18 to 30% of cases, with the majority of the mutations in exons 5 and 7.
19935649 report that ZEB1 not only promotes tumour cell dissemination, but is also necessary for the tumour-initiating capacity of pancreatic and colorectal cancer cells.
19921427 these results indicate that ZEB1 and AR regulate each other to promote cell migration in triple negative breast cancer cells
19754958 CtBP2 monomer interacts with a major CtBP-dependent repressor ZEB and HDAC and that the interaction of the two factors with the CtBP2 monomer was mutually exclusive.
19651985 Ladybird homeobox 1 (LBX1), a developmentally regulated homeobox gene, directs expression of the known EMT inducers ZEB1, ZEB2, Snail1, and transforming growth factor beta2 (TGFB2).
19584296 Immunohistochemical analysis of E-cadherin and Zeb-1 in primary tumors confirmed that expression of the two proteins was mutually exclusive.
19432861 The detailed clinical features of posterior polymorphous corneal dystrophy (PPCD) associated with a novel ZEB1 mutation are supportive of the previously proposed range of phenotype parameters.
19225155 These results extend the role of epithelial-to-mesenchymal transition in metastasis to transendothelial migration and implicate ZEB1 and N-cadherin in this process in prostate cancer cells.
19208835 Integral role for TCF8 in the regulation of pathologic angiogenesis, and possible use of TCF8 as a target for therapeutic intervention in cancer.
19194497 The pro-survival response of neurons, initiated through the rapid induction of p63, is mediated ultimately by the transcriptional repression of a pro-apoptotic isoform of p73 by ZEB1.
19177200 The results demonstrate that ZEB-1 directly inhibits SEMA3F expression in lung cancer cells.
19153669 E-cadherin, beta-catenin, and ZEB1 have roles in malignant progression of cancer [review]
19147758 DeltaEF1 controls the mesenchymal phenotype and drives erlotinib resistance in HNSCC cells
19116147 These findings suggest that Zeb1 represses T-cadherin expression and thus increases the invasive activity of gallbladder cancer.
19116136 TCF8 activates R-Ras, another class of angiogenic regulator, to suppress angiogenesis by a mechanism other than a transcriptional attenuator.
18984674 Observational study of gene-disease association. (HuGE Navigator)
18829540 A double-negative feedback loop controlling ZEB1-SIP1 and miR-200 family expression.
18622689 These data support the contention that high ZEB1 encourages gynecologic carcinoma progression.
18487993 ZEB1 may be a biomarker of aggressive endometrial cancers at high risk of recurrence.
18483486 These results indicate that ZEB1 triggers an microRNA-mediated feedforward loop that stabilizes the epithelial-mesenchymal transition and promotes invasion of cancer cells.
18467597 Down-regulation of TCF8 expression in ATLL cells was associated with resistance to TGF-beta1, a well-known characteristic of ATLL cells, suggesting that escape from TGF-beta1-mediated growth inhibition is important in the pathogenesis of ATLL
18411277 loss of expression of the miR-200 family members may play a critical role in the repression of E-cadherin by ZEB1 and ZEB2 during EMT, thereby enhancing migration and invasion during cancer progression.
18376396 Data show that miR-200 and -205 microRNAs cooperatively regulate expression of the E-cadherin transcriptional repressors ZEB1 (also known as deltaEF1) and SIP1 (also known as ZEB2), factors previously implicated in EMT and tumour metastasis.
18321996 These results lead to a new hypothesis that Snail and ZEB1 are downstream of CCN6 and play a critical role in CCN6-mediated regulation of E-cadherin in breast cancer.
18199550 ZEB1 is a crucial promoter of malignant tumor progression.
18172091 Observational study of gene-disease association. (HuGE Navigator)
18172091 The identification of a novel missense mutation in only one of the patients implied that TCF8 does not play a significant role in the pathogenesis of FECD in this Chinese population.
17936922 Based on these observations we suggest that bHLH factors recruit NFI to enhance skeletal muscle Na(+) channel expression.
17935237 Observational study of gene-disease association. (HuGE Navigator)
17935237 TCF8 gene mutations are associated with Posterior polymorphous corneal dystrophy and abdominal hernia
17610840 The Zfhx1a-1 gene is autoregulated in part by negative feedback on its own promoter which is, in turn, modified by the availability of the negative dominant isoform Zfhx1a-2.
17486063 Upregulation of ZEB1 is associated with colon and breast cancer progression
17437275 Four novel pathogenic mutations were identified in four families; two deletions, one nonsense, and one duplication within exon 7 in the ZEB1 gene at 10p11.2. Czech patients were genotyped for a founder haplotype and lack of 20p11.2 locus segregation.
17391671 The transcriptional repression of PKP3 by ZEB1 contributes to ZEB1-mediated disintegration of intercellular adhesion and epithelial to mesenchymal transition.
16952552 zinc-finger-enhancer protein 1 (ZEB1) is the crucial transcriptional repressor of BM components in CRCs.
16804902 Levels of expression of CtBP and p300 are critical for the action of SNAIL and ZEB1, which have a pivotal role in levels of epithelial-mesenchymsal transitionin human colon carcinoma.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16203744 In colon cancer parients, the correlation between the expression of SNAIL and the downregulation of E-cadherin (CDH1) is lost when ZEB1 is overexpressed
16087177 Data demonstrate that DNA methylation contributes to increased levels of p73 in Fanconi anemia cells by hampering the binding of the transcriptional repressor ZEB to an intronic regulatory region of the p73 gene.
14965470 an activator of transcription whose action may be DNA-context and cell-type specific, but not species specific.
12743039 while ZEB-1/deltaEF1 binds to p300 and promotes the formation of a p300-Smad transcriptional complex, ZEB-2/SIP1 acts as a repressor by recruiting CtBP
12743038 Data show that ZEB-1/deltaEF1 and ZEB-2/SIP1 are regulators of transforming growth factor beta/bone morphogenetic protein signaling, with opposing effects on this pathway.
12163027 These data provide the first demonstration that Zfhep is post-translationally modified.
12161443 ZEB1 plays a role in repressing E-cadherin and MUC1 in epithelial cells [ZEB-1]
11810028 HIV-1 Nef upregulates the expression of transcription factor 8 in HeLa cells

AA Sequence

MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPG      1 - 70
RSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFP     71 - 140
EAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFA    141 - 210
YRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHS    211 - 280
GSYSSHISSKKCISLIPVNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP    281 - 350
VDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV    351 - 420
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQ    421 - 490
NLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPP    491 - 560
LPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFE    561 - 630
KMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRS    631 - 700
STPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNL    701 - 770
SCAKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ    771 - 840
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCD    841 - 910
KIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMN    911 - 980
HRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEEL    981 - 1050
QEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEK   1051 - 1120
TNEA                                                                     1121 - 1124
//

Text Mined References (251)

PMID Year Title
26940738 2016 miR-1271 inhibits migration, invasion and epithelial-mesenchymal transition by targeting ZEB1 and TWIST1 in pancreatic cancer cells.
26898939 2016 LincRNA-ROR promotes invasion, metastasis and tumor growth in pancreatic cancer through activating ZEB1 pathway.
26882471 2016 ZEB1 Upregulates VEGF Expression and Stimulates Angiogenesis in Breast Cancer.
26876920 2016 ZEB1 turns into a transcriptional activator by interacting with YAP1 in aggressive cancer types.
26823172 2016 The potential role of regulator of G-protein signaling 16 in cell motility mediated by ?EF1 family proteins.
26717907 2016 SET8 induces epithelial?mesenchymal transition and enhances prostate cancer cell metastasis by cooperating with ZEB1.
26622166 2015 Association of ZEB1 and TCF4 rs613872 changes with late onset Fuchs endothelial corneal dystrophy in patients from northern India.
26619383 2016 Congenital Corneal Endothelial Dystrophies Resulting From Novel De Novo Mutations.
26617850 2015 ZEB1 promotes the progression and metastasis of cervical squamous cell carcinoma via the promotion of epithelial-mesenchymal transition.
26556542 2015 miR-590-3p suppresses cancer cell migration, invasion and epithelial-mesenchymal transition in glioblastoma multiforme by targeting ZEB1 and ZEB2.
26551670 2015 Genomic profiling of Sézary syndrome identifies alterations of key T cell signaling and differentiation genes.
26547370 2015 Nuclear, cytoplasmic, and stromal expression of ZEB1 in squamous and small cell carcinoma of the esophagus.
26546081 2016 Down-regulation of FBP1 by ZEB1-mediated repression confers to growth and invasion in lung cancer cells.
26540342 2016 An hTERT/ZEB1 complex directly regulates E-cadherin to promote epithelial-to-mesenchymal transition (EMT) in colorectal cancer.
26514226 2015 HOXD9 promotes epithelial-mesenchymal transition and cancer metastasis by ZEB1 regulation in hepatocellular carcinoma.
26498682 2015 MiR-652 inhibits acidic microenvironment-induced epithelial-mesenchymal transition of pancreatic cancer cells by targeting ZEB1.
26387539 2015 ZEB1 and TCF4 reciprocally modulate their transcriptional activities to regulate Wnt target gene expression.
26334100 2015 The ZEB1/miR-200c feedback loop regulates invasion via actin interacting proteins MYLK and TKS5.
26321866 2015 EMT-associated factors promote invasive properties of uveal melanoma cells.
26302187 2015 Involvement of ZEB1 and Snail1 in excessive production of extracellular matrix in Fuchs endothelial corneal dystrophy.
26297948 2015 Identification of a PEAK1/ZEB1 signaling axis during TGF?/fibronectin-induced EMT in breast cancer.
26275944 2015 MiR-205 promotes motility of ovarian cancer cells via targeting ZEB1.
26264186 2015 Inhibition of ZEB1 expression induces redifferentiation of adult human ? cells expanded in vitro.
26191328 2015 MicroRNA-144 regulates proliferation, invasion, and apoptosis of cells in malignant solitary pulmonary nodule via zinc finger E-box-binding homeobox 1.
26170011 2015 Expression of epithelial-mesenchymal transition-related markers in triple-negative breast cancer: ZEB1 as a potential biomarker for poor clinical outcome.
26077342 2015 A self-enforcing CD44s/ZEB1 feedback loop maintains EMT and stemness properties in cancer cells.
26073087 2016 Upregulation of long noncoding RNA ZEB1-AS1 promotes tumor metastasis and predicts poor prognosis in hepatocellular carcinoma.
26057751 2015 HIF-1? Promotes Epithelial-Mesenchymal Transition and Metastasis through Direct Regulation of ZEB1 in Colorectal Cancer.
26043676 2015 Expression of BMI1 and ZEB1 in epithelial-mesenchymal transition of tongue squamous cell carcinoma.
26022123 2015 miR-139-5p inhibits epithelial-mesenchymal transition, migration and invasion of hepatocellular carcinoma cells by targeting ZEB1 and ZEB2.
26011542 2015 53BP1 suppresses epithelial-mesenchymal transition by downregulating ZEB1 through microRNA-200b/429 in breast cancer.
25989272 2015 Expression of E-cadherin repressors SNAIL, ZEB1 and ZEB2 by tumour and stromal cells influences tumour-budding phenotype and suggests heterogeneity of stromal cells in pancreatic cancer.
25986864 2015 A Long Non-coding RNA Activated by Transforming Growth Factor-? is an Independent Prognostic Marker of Gastric Cancer.
25963537 2015 ZEB1 promotes epithelial-mesenchymal transition in cervical cancer metastasis.
25950745 2015 ZEB1 expression is correlated with tumor metastasis and reduced prognosis of breast carcinoma in Asian patients.
25921099 2015 miR-128 modulates chemosensitivity and invasion of prostate cancer cells through targeting ZEB1.
25910959 2015 CRTAM is negatively regulated by ZEB1 in T cells.
25896413 2015 MiR-10b Directly Targets ZEB1 and PIK3CA to Curb Adenomyotic Epithelial Cell Invasiveness via Upregulation of E-Cadherin and Inhibition of Akt Phosphorylation.
25890268 2015 ZEB1 transcriptionally regulated carbonic anhydrase 9 mediates the chemoresistance of tongue cancer via maintaining intracellular pH.
25880398 2015 An Rb1-dependent amplification loop between Ets1 and Zeb1 is evident in thymocyte differentiation and invasive lung adenocarcinoma.
25868853 2015 Cordycepin (3'-deoxyadenosine) suppressed HMGA2, Twist1 and ZEB1-dependent melanoma invasion and metastasis by targeting miR-33b.
25833697 2015 miR-139-5p suppresses cancer cell migration and invasion through targeting ZEB1 and ZEB2 in GBM.
25808945 2015 Loss of MicroRNA-101 Promotes Epithelial to Mesenchymal Transition in Hepatocytes.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25738863 2015 Proteasome inhibitor-resistant cells cause EMT-induction via suppression of E-cadherin by miR-200 and ZEB1.
25640197 2015 MiR-429 inhibits oral squamous cell carcinoma growth by targeting ZEB1.
25592037 2015 Hypoxia enhances migration and invasion in glioblastoma by promoting a mesenchymal shift mediated by the HIF1?-ZEB1 axis.
25544793 2014 ZEB1 expression in endometrial biopsy predicts lymph node metastases in patient with endometrial cancer.
25528765 2015 The ubiquitin ligase Siah is a novel regulator of Zeb1 in breast cancer.
25521330 2015 ZEB1 Promotes Invasion in Human Fetal Neural Stem Cells and Hypoxic Glioma Neurospheres.
25479687 2015 Clinicopathological analysis of pleomorphic carcinoma of the lung: diffuse ZEB1 expression predicts poor survival.
25476932 2014 miR-205 acts as a tumour radiosensitizer by targeting ZEB1 and Ubc13.
25455932 2015 The glycosyltransferase LARGE2 is repressed by Snail and ZEB1 in prostate cancer.
25441224 2015 Identification of six novel mutations in ZEB1 and description of the associated phenotypes in patients with posterior polymorphous corneal dystrophy 3.
25422078 2015 Pien Tze Huang inhibits metastasis of human colorectal carcinoma cells via modulation of TGF-?1/ZEB/miR-200 signaling network.
25405387 2015 miR-429 inhibits migration and invasion of breast cancer cells in vitro.
25348003 2014 Metastasis is regulated via microRNA-200/ZEB1 axis control of tumour cell PD-L1 expression and intratumoral immunosuppression.
25347933 2014 Immunohistochemical analysis of the expression of E-cadherin and ZEB1 in non-small cell lung cancer.
25344754 2014 ASPP2 controls epithelial plasticity and inhibits metastasis through ?-catenin-dependent regulation of ZEB1.
25315069 2015 ?EF1 associates with DNMT1 and maintains DNA methylation of the E-cadherin promoter in breast cancer cells.
25301070 2015 Fra-1/AP-1 induces EMT in mammary epithelial cells by modulating Zeb1/2 and TGF? expression.
25275602 2014 TGF-? is an inducer of ZEB1-dependent mesenchymal transdifferentiation in glioblastoma that is associated with tumor invasion.
25270213 2014 [Aberrant expressions of ?-catenin and ZEB1 in bladder cancer and their significance].
25261470 2014 MicroRNA-141 and microRNA-146b-5p inhibit the prometastatic mesenchymal characteristics through the RNA-binding protein AUF1 targeting the transcription factor ZEB1 and the protein kinase AKT.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25190660 2014 Functional impact of ZEB1 mutations associated with posterior polymorphous and Fuchs' endothelial corneal dystrophies.
25178837 2015 Zeb1 and Snail1 engage miR-200f transcriptional and epigenetic regulation during EMT.
25160502 2015 The presence of androgen receptor elements regulates ZEB1 expression in the absence of androgen receptor.
25155634 2015 Discoidin domain receptor 1 is a novel transcriptional target of ZEB1 in breast epithelial cells undergoing H-Ras-induced epithelial to mesenchymal transition.
25142232 2014 Overexpression of zinc finger E-box binding homeobox factor 1 promotes tumor invasiveness and confers unfavorable prognosis in esophageal squamous cell carcinoma.
25119590 2014 Molecular regulation of ovarian cancer cell invasion.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25090005 2014 MicroRNA-150 predicts a favorable prognosis in patients with epithelial ovarian cancer, and inhibits cell invasion and metastasis by suppressing transcriptional repressor ZEB1.
25086746 2014 ATM-mediated stabilization of ZEB1 promotes DNA damage response and radioresistance through CHK1.
25043300 2015 DAB2IP regulates cancer stem cell phenotypes through modulating stem cell factor receptor and ZEB1.
24968735 2015 Down-regulation of miR-144 promotes thyroid cancer cell invasion by targeting ZEB1 and ZEB2.
24929761 2014 Prognostic significance of Zinc finger E-box binding homeobox 1 (ZEB1) expression in cancer cells and cancer-associated fibroblasts in pancreatic head cancer.
24762440 2014 ZEB1 sensitizes lung adenocarcinoma to metastasis suppression by PI3K antagonism.
24756066 2014 Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1.
24643400 2014 ABCG2/BCRP gene expression is related to epithelial-mesenchymal transition inducer genes in a papillary thyroid carcinoma cell line (TPC-1).
24615544 2014 MiR-200c suppresses TGF-? signaling and counteracts trastuzumab resistance and metastasis by targeting ZNF217 and ZEB1 in breast cancer.
24577090 2014 Knockdown of BAG3 induces epithelial-mesenchymal transition in thyroid cancer cells through ZEB1 activation.
24573236 2014 miR-1236-3p represses the cell migration and invasion abilities by targeting ZEB1 in high-grade serous ovarian carcinoma.
24468793 2014 Inhibition of TBK1 attenuates radiation-induced epithelial-mesenchymal transition of A549 human lung cancer cells via activation of GSK-3? and repression of ZEB1.
24400868 2014 Arecoline-induced myofibroblast transdifferentiation from human buccal mucosal fibroblasts is mediated by ZEB1.
24390222 2014 Inhibition of ZEB1 by miR-200 characterizes Helicobacter pylori-positive gastric diffuse large B-cell lymphoma with a less aggressive behavior.
24348007 2013 Genetic screen of African Americans with Fuchs endothelial corneal dystrophy.
24306957 2014 Expression of miRNAs and ZEB1 and ZEB2 correlates with histopathological grade in papillary urothelial tumors of the urinary bladder.
24305877 2014 CUL4A induces epithelial-mesenchymal transition and promotes cancer metastasis by regulating ZEB1 expression.
24304617 2013 Clinical implication of ZEB-1 and E-cadherin expression in hepatocellular carcinoma (HCC).
24304426 2014 A survey of zeb1, twist and claudin 1 and 4 expression during placental development and disease.
24283570 2013 Direct repression of MYB by ZEB1 suppresses proliferation and epithelial gene expression during epithelial-to-mesenchymal transition of breast cancer cells.
24277930 2014 A p21-ZEB1 complex inhibits epithelial-mesenchymal transition through the microRNA 183-96-182 cluster.
24257549 2013 Effect of down-regulated transcriptional repressor ZEB1 on the epithelial-mesenchymal transition of ovarian cancer cells.
24165969 2014 Langerhans cell maturation is accompanied by induction of N-cadherin and the transcriptional regulators of epithelial-mesenchymal transition ZEB1/2.
24154725 2013 MicroRNA-based regulation of epithelial-hybrid-mesenchymal fate determination.
24127332 2013 A miRNA signature associated with human metastatic medullary thyroid carcinoma.
24113819 2013 Classification of posterior polymorphous corneal dystrophy as a corneal ectatic disorder following confirmation of associated significant corneal steepening.
24067373 2013 Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation.
23994666 2013 Epithelio-mesenchymal transitional attributes in oral sub-mucous fibrosis.
23957009 2013 miR-1279, miR-548j, miR-548m, and miR-548d-5p binding sites in CDSs of paralogous and orthologous PTPN12, MSH6, and ZEB1 Genes.
23890107 2013 GLI2 cooperates with ZEB1 for transcriptional repression of CDH1 expression in human melanoma cells.
23869586 2013 Coordinated regulation of ?-tubulin isotypes and epithelial-to-mesenchymal transition protein ZEB1 in breast cancer cells.
23844063 2013 MicroRNA-23b functions as a tumor suppressor by regulating Zeb1 in bladder cancer.
23827675 2013 Poised chromatin at the ZEB1 promoter enables breast cancer cell plasticity and enhances tumorigenicity.
23818228 2013 The ZEB1 pathway links glioblastoma initiation, invasion and chemoresistance.
23814079 2013 Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer.
23807282 2013 Further genetic and clinical insights of posterior polymorphous corneal dystrophy 3.
23791009 2013 The nuclear protein expression levels of SNAI1 and ZEB1 are involved in the progression and lymph node metastasis of cervical cancer via the epithelial-mesenchymal transition pathway.
23765923 2013 MicroRNA-200C and -150 play an important role in endothelial cell differentiation and vasculogenesis by targeting transcription repressor ZEB1.
23743934 2013 ZEB1 overexpression associated with E-cadherin and microRNA-200 downregulation is characteristic of undifferentiated endometrial carcinoma.
23690952 2013 miR-655 Is an EMT-suppressive microRNA targeting ZEB1 and TGFBR2.
23667256 2013 Zeb1 regulates E-cadherin and Epcam (epithelial cell adhesion molecule) expression to control cell behavior in early zebrafish development.
23599324 2013 Mutational spectrum of the ZEB1 gene in corneal dystrophies supports a genotype-phenotype correlation.
23591815 2013 Loss of Git2 induces epithelial-mesenchymal transition by miR146a-Cnot6L-controlled expression of Zeb1.
23584475 2014 MUC1-C oncoprotein activates the ZEB1/miR-200c regulatory loop and epithelial-mesenchymal transition.
23565224 2013 Helicobacter pylori initiates a mesenchymal transition through ZEB1 in gastric epithelial cells.
23559851 2013 Exclusion of pathogenic promoter region variants and identification of novel nonsense mutations in the zinc finger E-box binding homeobox 1 gene in posterior polymorphous corneal dystrophy.
23412770 2013 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23381389 2013 Downregulated microRNA-200a promotes EMT and tumor growth through the wnt/?-catenin pathway by targeting the E-cadherin repressors ZEB1/ZEB2 in gastric adenocarcinoma.
23358160 2014 Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci.
23318438 2014 WASF3 regulates miR-200 inactivation by ZEB1 through suppression of KISS1 leading to increased invasiveness in breast cancer cells.
23285017 2012 ?EF1 down-regulates ER-? expression and confers tamoxifen resistance in breast cancer.
23255418 2013 Inhibition of ZEB1 reverses EMT and chemoresistance in docetaxel-resistant human lung adenocarcinoma cell line.
23190132 2013 Biological roles and prognostic values of the epithelial-mesenchymal transition-mediating transcription factors Twist, ZEB1 and Slug in diffuse large B-cell lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065281 2013 Involvement of ZEB1 and E-cadherin in the invasion of lung squamous cell carcinoma.
23038259 2012 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23030626 2013 Expression of snail, twist, and Zeb1 in malignant mesothelioma.
23013135 2013 MiR-150 is associated with poor prognosis in esophageal squamous cell carcinoma via targeting the EMT inducer ZEB1.
22892238 2013 Epithelial-mesenchymal transition transcription factor ZEB1/ZEB2 co-expression predicts poor prognosis and maintains tumor-initiating properties in head and neck cancer.
22850877 2012 ZEB1 drives prometastatic actin cytoskeletal remodeling by downregulating miR-34a expression.
22847613 2013 Mutant p53 gain-of-function induces epithelial-mesenchymal transition through modulation of the miR-130b-ZEB1 axis.
22820858 2012 Expression of the E-cadherin repressors Snail, Slug and Zeb1 in urothelial carcinoma of the urinary bladder: relation to stromal fibroblast activation and invasive behaviour of carcinoma cells.
22685266 2012 miR-200c is aberrantly expressed in leiomyomas in an ethnic-dependent manner and targets ZEBs, VEGFA, TIMP2, and FBLN5.
22652173 2012 Activation of canonical WNT/?-catenin signaling enhances in vitro motility of glioblastoma cells by activation of ZEB1 and other activators of epithelial-to-mesenchymal transition.
22481253 2012 Lentivirus-delivered ZEB-1 small interfering RNA inhibits lung adenocarcinoma cell growth in vitro and in vivo.
22466758 2012 Overexpression of ZEB1 associated with metastasis and invasion in patients with gastric carcinoma.
22391641 2012 Androgen receptor is overexpressed in boys with severe hypospadias, and ZEB1 regulates androgen receptor expression in human foreskin cells.
22286765 2012 SIX1 promotes epithelial-mesenchymal transition in colorectal cancer through ZEB1 activation.
22262832 2012 Induction of ZEB proteins by inactivation of RB protein is key determinant of mesenchymal phenotype of breast cancer.
22213144 2012 Epithelial-mesenchymal transition and mesenchymal-epithelial transition via regulation of ZEB-1 and ZEB-2 expression in pancreatic cancer.
22213004 2012 Overexpression of ZEB1 relates to metastasis and invasion in osteosarcoma.
22212097 2012 Zinc finger E-box binding homeobox 1 promotes vasculogenic mimicry in colorectal cancer through induction of epithelial-to-mesenchymal transition.
22205962 2011 E-cadherin is transcriptionally activated via suppression of ZEB1 transcriptional repressor by small RNA-mediated gene silencing.
22205702 2012 Roles of STAT3 and ZEB1 proteins in E-cadherin down-regulation and human colorectal cancer epithelial-mesenchymal transition.
22199242 2012 Analysis of the role of ZEB1 in the pathogenesis of posterior polymorphous corneal dystrophy.
22162761 2011 C-peptide increases Na,K-ATPase expression via PKC- and MAP kinase-dependent activation of transcription factor ZEB in human renal tubular cells.
22095522 2012 Clinical significance of Zinc finger E-box Binding homeobox 1 (ZEB1) in human gastric cancer.
22086445 2012 Transient but not stable ZEB1 knockdown dramatically inhibits growth of malignant pleural mesothelioma cells.
22080605 2011 ?-catenin/TCF4 complex induces the epithelial-to-mesenchymal transition (EMT)-activator ZEB1 to regulate tumor invasiveness.
21955614 2011 Differential expression of microRNA expression in tamoxifen-sensitive MCF-7 versus tamoxifen-resistant LY2 human breast cancer cells.
21890822 2011 A NOTCH3-mediated squamous cell differentiation program limits expansion of EMT-competent cells that express the ZEB transcription factors.
21791114 2011 ZEB1 limits adenoviral infectability by transcriptionally repressing the coxsackie virus and adenovirus receptor.
21747944 2011 TMPRSS2/ERG promotes epithelial to mesenchymal transition through the ZEB1/ZEB2 axis in a prostate cancer model.
21717425 2012 Zinc finger E-box binding factor 1 plays a central role in regulating Epstein-Barr virus (EBV) latent-lytic switch and acts as a therapeutic target in EBV-associated gastric cancer.
21643654 2011 Inducible expression of TGF?, snail and Zeb1 recapitulates EMT in vitro and in vivo in a NSCLC model.
21593765 2011 Transcriptional activation of ZEB1 by Slug leads to cooperative regulation of the epithelial-mesenchymal transition-like phenotype in melanoma.
21584833 2012 Clinicopathological significance of ZEB1 protein in patients with hepatocellular carcinoma.
21527937 2011 miR-200c is upregulated by oxidative stress and induces endothelial cell apoptosis and senescence via ZEB1 inhibition.
21525039 2011 CCN6 (WISP3) decreases ZEB1-mediated EMT and invasion by attenuation of IGF-1 receptor signaling in breast cancer.
21518799 2011 p53 regulates epithelial-mesenchymal transition through microRNAs targeting ZEB1 and ZEB2.
21411626 2011 An autocrine TGF-beta/ZEB/miR-200 signaling network regulates establishment and maintenance of epithelial-mesenchymal transition.
21324165 2011 Transcription factors zeb1, twist and snai1 in breast carcinoma.
21317430 2011 Functional cooperation between Snail1 and twist in the regulation of ZEB1 expression during epithelial to mesenchymal transition.
21315410 2011 Nuclear Snail1 and nuclear ZEB1 protein expression in invasive and intraductal human breast carcinomas.
21269460 2011 Initial characterization of the human central proteome.
21241837 2011 ?EF1 promotes osteolytic metastasis of MDA-MB-231 breast cancer cells by regulating MMP-1 expression.
21224848 2011 The ZEB1/miR-200 feedback loop controls Notch signalling in cancer cells.
21079000 2010 miR-200 family and targets, ZEB1 and ZEB2, modulate uterine quiescence and contractility during pregnancy and labor.
21067486 2010 Variable ocular phenotypes of posterior polymorphous corneal dystrophy caused by mutations in the ZEB1 gene.
20980099 2011 ZEB1-responsive genes in non-small cell lung cancer.
20970163 2011 Repression of E-cadherin by SNAIL, ZEB1, and TWIST in invasive ductal carcinomas of the breast: a cooperative effort?
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20731704 2010 Identification of DeltaEF1 as a novel target that is negatively regulated by LMO2 in T-cell leukemia.
20729552 2010 ZEB1 coordinately regulates laminin-332 and {beta}4 integrin expression altering the invasive phenotype of prostate cancer cells.
20514018 2010 Downregulation of ZEB1 and overexpression of Smad7 contribute to resistance to TGF-beta1-mediated growth suppression in adult T-cell leukemia/lymphoma.
20452118 2010 Knockdown of ZEB1, a master epithelial-to-mesenchymal transition (EMT) gene, suppresses anchorage-independent cell growth of lung cancer cells.
20424117 2010 Epidermal growth factor receptor and mutant p53 expand an esophageal cellular subpopulation capable of epithelial-to-mesenchymal transition through ZEB transcription factors.
20418909 2010 ZEB1 represses E-cadherin and induces an EMT by recruiting the SWI/SNF chromatin-remodeling protein BRG1.
20375168 2010 Either ZEB1 or ZEB2/SIP1 can play a central role in regulating the Epstein-Barr virus latent-lytic switch in a cell-type-specific manner.
20175752 2010 ZEB1 and CtBP form a repressive complex at a distal promoter element of the BCL6 locus.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20036349 2010 Missense mutations in TCF8 cause late-onset Fuchs corneal dystrophy and interact with FCD4 on chromosome 9p.
19997581 2009 Phenotypic characterisation and ZEB1 mutational analysis in posterior polymorphous corneal dystrophy in a New Zealand population.
19935649 2009 The EMT-activator ZEB1 promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
19921427 2010 Reciprocal regulation of ZEB1 and AR in triple negative breast cancer cells.
19754958 2009 Interaction of ZEB and histone deacetylase with the PLDLS-binding cleft region of monomeric C-terminal binding protein 2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19651985 2009 A developmentally regulated inducer of EMT, LBX1, contributes to breast cancer progression.
19584296 2009 Epithelial to mesenchymal transition contributes to drug resistance in pancreatic cancer.
19432861 2010 Clinical phenotype of posterior polymorphous corneal dystrophy in a family with a novel ZEB1 mutation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19225155 2009 ZEB1 enhances transendothelial migration and represses the epithelial phenotype of prostate cancer cells.
19208835 2009 Integral role of transcription factor 8 in the negative regulation of tumor angiogenesis.
19194497 2009 ZEB1 links p63 and p73 in a novel neuronal survival pathway rapidly induced in response to cortical ischemia.
19177200 2009 ZEB-1, a repressor of the semaphorin 3F tumor suppressor gene in lung cancer cells.
19153669 2009 E-cadherin, beta-catenin, and ZEB1 in malignant progression of cancer.
19147758 2009 Delta-crystallin enhancer binding factor 1 controls the epithelial to mesenchymal transition phenotype and resistance to the epidermal growth factor receptor inhibitor erlotinib in human head and neck squamous cell carcinoma lines.
19116147 2009 Zeb1-mediated T-cadherin repression increases the invasive potential of gallbladder cancer.
19116136 2009 Transcription factor 8 activates R-Ras to regulate angiogenesis.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
18829540 2008 A double-negative feedback loop between ZEB1-SIP1 and the microRNA-200 family regulates epithelial-mesenchymal transition.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18622689 2008 Expression of the ZEB1 (deltaEF1) transcription factor in human: additional insights.
18487993 2008 ZEB1 expression in type I vs type II endometrial cancers: a marker of aggressive disease.
18483486 2008 A reciprocal repression between ZEB1 and members of the miR-200 family promotes EMT and invasion in cancer cells.
18467597 2008 Down-regulation of TCF8 is involved in the leukemogenesis of adult T-cell leukemia/lymphoma.
18411277 2008 The miR-200 family inhibits epithelial-mesenchymal transition and cancer cell migration by direct targeting of E-cadherin transcriptional repressors ZEB1 and ZEB2.
18376396 2008 The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1.
18321996 2008 Inhibition of CCN6 (Wnt-1-induced signaling protein 3) down-regulates E-cadherin in the breast epithelium through induction of snail and ZEB1.
18199550 2008 The transcriptional repressor ZEB1 promotes metastasis and loss of cell polarity in cancer.
18172091 2008 Analysis of the posterior polymorphous corneal dystrophy 3 gene, TCF8, in late-onset Fuchs endothelial corneal dystrophy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936922 Basic helix-loop-helix factors recruit nuclear factor I to enhance expression of the NaV 1.4 Na+ channel gene.
17935237 2007 Posterior polymorphous corneal dystrophy is associated with TCF8 gene mutations and abdominal hernia.
17610840 2007 The ZFHX1A gene is differentially autoregulated by its isoforms.
17486063 2007 The transcription factor ZEB1 (deltaEF1) promotes tumour cell dedifferentiation by repressing master regulators of epithelial polarity.
17437275 2007 Novel mutations in the ZEB1 gene identified in Czech and British patients with posterior polymorphous corneal dystrophy.
17391671 2007 The transcription factor ZEB1 (deltaEF1) represses Plakophilin 3 during human cancer progression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16952552 2006 A transient, EMT-linked loss of basement membranes indicates metastasis and poor survival in colorectal cancer.
16804902 2006 The expression levels of the transcriptional regulators p300 and CtBP modulate the correlations between SNAIL, ZEB1, E-cadherin and vitamin D receptor in human colon carcinomas.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16252232 2005 Mutations in TCF8 cause posterior polymorphous corneal dystrophy and ectopic expression of COL4A3 by corneal endothelial cells.
16203744 2005 E-cadherin and vitamin D receptor regulation by SNAIL and ZEB1 in colon cancer: clinicopathological correlations.
16087177 2005 Defective binding of transcriptional repressor ZEB via DNA methylation contributes to increased constitutive levels of p73 in Fanconi anemia cells.
16061479 2005 Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15384081 2004 A locus for posterior polymorphous corneal dystrophy (PPCD3) maps to chromosome 10.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14965470 2004 Transcriptional activation by the zinc-finger homeodomain protein delta EF1 in estrogen signaling cascades.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12937339 2003 WNT7a induces E-cadherin in lung cancer cells.
12743039 2003 Regulation of Smad signaling through a differential recruitment of coactivators and corepressors by ZEB proteins.
12743038 2003 Opposing functions of ZEB proteins in the regulation of the TGFbeta/BMP signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163027 2002 Cell-specific phosphorylation of Zfhep transcription factor.
12161443 2002 Snail induction of epithelial to mesenchymal transition in tumor cells is accompanied by MUC1 repression and ZEB1 expression.
11760832 2001 Assessment of gene regulation by bone morphogenetic protein 2 in human marrow stromal cells using gene array technology.
11275565 2001 Tip60 is a cell-type-specific transcriptional regulator.
10359772 1999 ZEB represses transcription through interaction with the corepressor CtBP.
9724649 1998 Cloning and characterization of mCtBP2, a co-repressor that associates with basic Krüppel-like factor and other mammalian transcriptional regulators.
9418848 1998 Involvement of negative cofactor NC2 in active repression by zinc finger-homeodomain transcription factor AREB6.
8138542 1993 Transcription factors positively and negatively regulating the Na,K-ATPase alpha 1 subunit gene.
7935395 1994 BZP, a novel serum-responsive zinc finger protein that inhibits gene transcription.
1840704 1991 Identification of a zinc finger protein that inhibits IL-2 gene expression.
1427828 1992 The TCF8 gene encoding a zinc finger protein (Nil-2-a) resides on human chromosome 10p11.2.