| Tbio | Palmitoyltransferase ZDHHC3 |
Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi. May also palmitoylate DLG4, DNAJC5 and SNAP25.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7933 | 6.4e-07 |
| atypical teratoid / rhabdoid tumor | 4369 | 3.6e-05 |
| medulloblastoma, large-cell | 6234 | 5.2e-05 |
| interstitial cystitis | 2299 | 3.5e-04 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 5.6e-04 |
| group 4 medulloblastoma | 1875 | 8.4e-04 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 2.9e-03 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | -1.906 | 6.4e-07 |
| atypical teratoid / rhabdoid tumor | -1.100 | 3.6e-05 |
| medulloblastoma, large-cell | -1.400 | 5.2e-05 |
| intraductal papillary-mucinous adenoma (... | 1.100 | 2.9e-03 |
| intraductal papillary-mucinous carcinoma... | 1.400 | 5.6e-04 |
| interstitial cystitis | -1.100 | 3.5e-04 |
| group 4 medulloblastoma | -1.100 | 8.4e-04 |
| PMID | Text | |
|---|---|---|
| 23687301 | In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes. | |
| 22314500 | Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin alpha6beta4. | |
| 22240897 | GODZ regulates plasma membrane targeting of DR4 and thus TRAIL/DR4-mediated apoptosis in cancer cells. | |
| 19955568 | Data conclude that GODZ encodes a Ca(2+) transport protein in addition to its ability to palmitoylate protein substrates. |
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPS 1 - 70 RDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRA 71 - 140 HHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSP 141 - 210 PTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGW 211 - 280 ASPFATPDQGKADPYQYVV 281 - 299 //
| PMID | Year | Title | |
|---|---|---|---|
| 24927181 | 2014 | Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris. | |
| 23687301 | 2013 | In silico screening for palmitoyl substrates reveals a role for DHHC1/3/10 (zDHHC1/3/11)-mediated neurochondrin palmitoylation in its targeting to Rab5-positive endosomes. | |
| 23034182 | 2012 | Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system. | |
| 22314500 | 2012 | Palmitoylation by DHHC3 is critical for the function, expression, and stability of integrin ?6?4. | |
| 22240897 | 2012 | Regulation in the targeting of TRAIL receptor 1 to cell surface via GODZ for TRAIL sensitivity in tumor cells. | |
| 19955568 | 2010 | Golgi-specific DHHC zinc finger protein GODZ mediates membrane Ca2+ transport. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. | |
| 16713569 | 2006 | A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration. | |
| 16647879 | 2006 | Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins. | |
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15231748 | 2004 | Functional proteomics mapping of a human signaling pathway. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12163046 | 2002 | Isolation and characterization of Golgi apparatus-specific GODZ with the DHHC zinc finger domain. | |
| 9110174 | 1997 | Large-scale concatenation cDNA sequencing. | |
| 8619474 | 1996 | A "double adaptor" method for improved shotgun library construction. |
