Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.88
PubTator Score 19.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (2)

PMID Text
17123647 APH2 contains a zf-DHHC domain (148-210aa), which is involved in protein-protein or protein-DNA interaction.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYW      1 - 70
LVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTP     71 - 140
PGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLG    141 - 210
CVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHKSLVYLWFLCSSVALA    211 - 280
LGALTVWHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPS    281 - 350
SHLPHGNGMSWEPPPWVTAHSASVMAV                                               351 - 377
//

Text Mined References (10)

PMID Year Title
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17123647 Molecular cloning and characterization of human Aph2 gene, involved in AP-1 regulation by interaction with JAB1.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12021275 2002 Aph2, a protein with a zf-DHHC motif, interacts with c-Abl and has pro-apoptotic activity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.