Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.25
PubTator Score 19.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Gene RIF (2)

AA Sequence

MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYW      1 - 70
LVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTP     71 - 140
PGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLG    141 - 210
CVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHKSLVYLWFLCSSVALA    211 - 280
LGALTVWHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPS    281 - 350
SHLPHGNGMSWEPPPWVTAHSASVMAV                                               351 - 377
//

Text Mined References (11)

PMID Year Title