Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.82
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.1e-02
psoriasis 1.900 6.6e-04
osteosarcoma 3.097 1.6e-09
medulloblastoma, large-cell -1.100 1.0e-03
intraductal papillary-mucinous adenoma (... 1.200 1.4e-04
intraductal papillary-mucinous carcinoma... 1.400 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-02
lung cancer -1.400 1.4e-03
spina bifida -1.749 3.0e-02
Pick disease 1.100 2.9e-04
acute myeloid leukemia 1.600 1.1e-02

Gene RIF (1)

PMID Text
19847924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRI      1 - 70
VLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCTEVLEGNPTVLCQKLNHGSDH     71 - 140
QSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEM    141 - 210
ASQDGEEGASDSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEH    211 - 280
TVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSEN    281 - 350
IEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK    351 - 420
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN                           421 - 467
//

Text Mined References (14)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19847924 2010 Detecting rare variants for complex traits using family and unrelated data.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16542149 2006 The zinc finger protein ZNF297B interacts with BDP1, a subunit of TFIIIB.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.