Property Summary

NCBI Gene PubMed Count 27
PubMed Score 3.68
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 4.9e-12
osteosarcoma 7933 1.1e-04
ovarian cancer 8491 6.2e-04
Multiple myeloma 1327 1.2e-03
astrocytoma 1493 1.6e-03
Disease Target Count Z-score Confidence
Brachydactyly 52 3.131 1.6
Disease Target Count
Grange syndrome 1

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.047 1.2e-03
osteosarcoma -1.222 1.1e-04
astrocytoma 1.500 1.6e-03
lung adenocarcinoma 1.100 4.9e-12
ovarian cancer 1.500 6.2e-04

Gene RIF (13)

PMID Text
26667495 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions
25798835 activates YAP and stimulates cancer cell growth. Knockdown of ERBB3 or HBEGF eliminates YAP effects on cell growth and transformation
25597408 YY1AP1 may serve as a key molecular target for EpCAM(+) AFP(+) HCC subtype
24747426 knowledge of how YAP and TAZ function as mechanosensors and mechanotransducers
24485923 we report that YAP and its downstream transcriptional targets CCN1 and CCN2 are markedly elevated in keratinocytes in human skin basal cell carcinoma
23954413 Study reports that physical and architectural features of a multicellular sheet inform cells about their proliferative capacity through mechanical regulation of YAP and TAZ, known mediators of Hippo signaling and organ growth. YAP/TAZ activity is confined to cells exposed to mechanical stresses.
23450633 F-Actin, assembled in response to Galpha12/13 induced RhoA-GTP, promotes dephosphorylation and activation of the YAP oncogene.
23258147 The expression of YAP/TAZ and ECM-related-genes is impacted on physiologically relevant substrates. YAP was upregulated in cells on softer substrates.
22895435 Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape.
21278236 Data suggest that defective expression of LATS2 is attributable to FOXP3 defects and may be a major independent determinant of YAP protein elevation in cancer.
17541814 HCCA2 may play a novel role in cell cycle regulation.
14744866 YY1AP is a novel co-activator of YY1
11856496 human liver cancer associated gene

AA Sequence

MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDL      1 - 70
FETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQ     71 - 140
QKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFA    141 - 210
QSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKV    211 - 280
FMYPELLPVCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVL    281 - 350
GKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSEL    351 - 420
GSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPS    421 - 490
KMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMP    491 - 560
SPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQS    561 - 630
PQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQG    631 - 700
LEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQALEPLPQGIQESLN    701 - 770
NSSPGDLEEVVKMEPEDATEEISGFL                                                771 - 796
//

Text Mined References (29)

PMID Year Title
26667495 2015 A YAP/TAZ-miR-130/301 molecular circuit exerts systems-level control of fibrosis in a network of human diseases and physiologic conditions.
25798835 2015 YAP forms autocrine loops with the ERBB pathway to regulate ovarian cancer initiation and progression.
25597408 2015 Integrative genomics identifies YY1AP1 as an oncogenic driver in EpCAM(+) AFP(+) hepatocellular carcinoma.
24747426 2014 YAP/TAZ as mechanosensors and mechanotransducers in regulating organ size and tumor growth.
24485923 2014 Elevated YAP and its downstream targets CCN1 and CCN2 in basal cell carcinoma: impact on keratinocyte proliferation and stromal cell activation.
23954413 2013 A mechanical checkpoint controls multicellular growth through YAP/TAZ regulation by actin-processing factors.
23450633 2013 G protein-coupled receptors engage the mammalian Hippo pathway through F-actin: F-Actin, assembled in response to Galpha12/13 induced RhoA-GTP, promotes dephosphorylation and activation of the YAP oncogene.
23258147 2013 Role of substratum stiffness in modulating genes associated with extracellular matrix and mechanotransducers YAP and TAZ.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895435 2012 Transduction of mechanical and cytoskeletal cues by YAP and TAZ.
21278236 2011 Identification of a tumor suppressor relay between the FOXP3 and the Hippo pathways in breast and prostate cancers.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17541814 2007 Hepatocellular carcinoma-associated gene 2 interacts with MAD2L2.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14744866 2004 YY1AP, a novel co-activator of YY1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118372 2002 Molecular cloning and characterization of a novel gene which is highly expressed in hepatocellular carcinoma.
11710830 2001 Identification and characterization of a novel human hepatocellular carcinoma-associated gene.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.